(data stored in ACNUC7421 zone)

EMBL: CR954246.THIF

CR954246.THIF        Location/Qualifiers
FT   CDS             502940..503686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="PSHAa0485"
FT                   /product="putative adenylyltransferase; thiamine
FT                   biosynthesis protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9632726, 8432721; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85581"
FT                   /db_xref="GOA:Q3IFN4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN4"
FT                   /protein_id="CAI85581.1"
FT                   /translation="MNELSDKEMLRYSRHILLKEVGLAGQLKLKSASVAVVGAGGLGSP
FT                   ALLYLAAAGIGKLILIDDDAVELSNLQRQVLYKVNHLGQKKVVAAGKVLASLNNQITII
FT                   THAEKLTQDNSAALLNNADIVLDCSDNFTTRYSVNRFCVQHKTPLISGAALATKGQLIS
FT                   LDLRNANSPCYGCIFPQSDIAPLINCDNAGVISPLLGIIGSMQAQLTLNMLLSHSSDCV
FT                   FMSINALTLQQQQFKVVKDIDCKECR"
     MNELSDKEML RYSRHILLKE VGLAGQLKLK SASVAVVGAG GLGSPALLYL AAAGIGKLIL        60
     IDDDAVELSN LQRQVLYKVN HLGQKKVVAA GKVLASLNNQ ITIITHAEKL TQDNSAALLN       120
     NADIVLDCSD NFTTRYSVNR FCVQHKTPLI SGAALATKGQ LISLDLRNAN SPCYGCIFPQ       180
     SDIAPLINCD NAGVISPLLG IIGSMQAQLT LNMLLSHSSD CVFMSINALT LQQQQFKVVK       240
     DIDCKECR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page