(data stored in ACNUC7421 zone)

EMBL: CR954246.THIG

CR954246.THIG        Location/Qualifiers
FT   CDS             500588..501379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PSHAa0483"
FT                   /product="thiazole biosynthesis protein"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85579"
FT                   /db_xref="GOA:Q3IFN6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN6"
FT                   /protein_id="CAI85579.1"
FT                   /translation="MPNNDYLTIYGEQIKSRLLIGSALYPSPAVMNESIVASGAEIVTV
FT                   SLRRQQSAAAGDDFWQLIKNTGLKILPNTAGCHSVKEAITLAKMCREVFATDWIKLELI
FT                   GDDYNLQPDPFALLEATKILIDDGFKVLPYCTDDLVLCQRLNALGCEVLMPWGAPIGTG
FT                   KGLLNSYNLKTIRERLPEATLIVDAGLGLPSHACQALELGYDAVLLNSAIAGAGCPITM
FT                   SRAFKAAVEAGRFAYNAKAMPEKDVAAPSTPTMGMPFWHQE"
     MPNNDYLTIY GEQIKSRLLI GSALYPSPAV MNESIVASGA EIVTVSLRRQ QSAAAGDDFW        60
     QLIKNTGLKI LPNTAGCHSV KEAITLAKMC REVFATDWIK LELIGDDYNL QPDPFALLEA       120
     TKILIDDGFK VLPYCTDDLV LCQRLNALGC EVLMPWGAPI GTGKGLLNSY NLKTIRERLP       180
     EATLIVDAGL GLPSHACQAL ELGYDAVLLN SAIAGAGCPI TMSRAFKAAV EAGRFAYNAK       240
     AMPEKDVAAP STPTMGMPFW HQE                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page