(data stored in ACNUC7421 zone)

EMBL: CR954246.THIO

CR954246.THIO        Location/Qualifiers
FT   CDS             499379..500380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="PSHAa0481"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85577"
FT                   /db_xref="GOA:Q3IFN8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN8"
FT                   /protein_id="CAI85577.1"
FT                   /translation="MFYNIAVVGFGLTGRLAALELSKQHRVTVFEADDEHSQNSAGKVA
FT                   AAMLAPLAESVLCEADLALMGLDSIKRWPGIIDKLDSEVFFQQQGTLVVAHQQDKGDLL
FT                   SFAQRLKPLANYTGESVNSQQIEMLEPELANRFSQGLFLPCDGQIDNQAFYQASFTQLN
FT                   KRKVKFVFNQRVTINDNKINNREFDYIIDCRGLGAKDDKPLRGVRGEVARLYAPEVSLT
FT                   RPVRLMHPRYPIYIAPKPNNEYVIGATEIESQDTGPATVRSALELLSAAYTVHSGFAEA
FT                   RLLNIQTGLRPAFSDNRPQVTHVGRVISINGLYRHGYMLAPSLVANALLCIE"
     MFYNIAVVGF GLTGRLAALE LSKQHRVTVF EADDEHSQNS AGKVAAAMLA PLAESVLCEA        60
     DLALMGLDSI KRWPGIIDKL DSEVFFQQQG TLVVAHQQDK GDLLSFAQRL KPLANYTGES       120
     VNSQQIEMLE PELANRFSQG LFLPCDGQID NQAFYQASFT QLNKRKVKFV FNQRVTINDN       180
     KINNREFDYI IDCRGLGAKD DKPLRGVRGE VARLYAPEVS LTRPVRLMHP RYPIYIAPKP       240
     NNEYVIGATE IESQDTGPAT VRSALELLSA AYTVHSGFAE ARLLNIQTGL RPAFSDNRPQ       300
     VTHVGRVISI NGLYRHGYML APSLVANALL CIE                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page