(data stored in ACNUC7421 zone)

EMBL: CR954246.TRKA

CR954246.TRKA        Location/Qualifiers
FT   CDS             complement(22631..24007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PSHAa0020"
FT                   /product="Trk system; major constitutive K+ transport
FT                   system; potassium transport inner membrane protein subunit;
FT                   six transmembrane channel"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10214935, 10490030, 11301020; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85134"
FT                   /db_xref="GOA:Q3IDH2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH2"
FT                   /protein_id="CAI85134.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGEQNEITVVDIDGNRLRELQDKYDL
FT                   QGVAGHGAHPDVLRRAGAEDADMIIAVTSSDEVNMVACQVAYSIFNTPTKIARIRSEQY
FT                   LKYREKLFHNDDLPVDHYIAPEALVTKYIRRLIDYPGALQVLQFADGMLSLVAVKAYYG
FT                   GLLVGYALSTLKQHIPNVETRVAAIYRQGKAIKPLGTTIIEADDEVFFIAATKHIRAVM
FT                   NELQRLERSYKNIMIAGGGNIGAGLARSLEKNHSVKLIERSKERAEQLSEMLDNTIVFC
FT                   GDASDQELLSEEHIDQVDVFIAVTNDDEVNIMSAMLAKRMGAQKTMVLIQRSAYVDLVQ
FT                   GGDIDIAISPQEATISALLTHVRRGDIVNVYSLRKGAAEAIEAVAHGDENTSKVVGRTV
FT                   RDIKLPAGTTIGAVVRNDDVLIAHDDTIIMSGDHVIMFLIDKKHINIVEKLFQVSAIFL
FT                   "
     MKIIILGAGQ VGGTLAENLV GEQNEITVVD IDGNRLRELQ DKYDLQGVAG HGAHPDVLRR        60
     AGAEDADMII AVTSSDEVNM VACQVAYSIF NTPTKIARIR SEQYLKYREK LFHNDDLPVD       120
     HYIAPEALVT KYIRRLIDYP GALQVLQFAD GMLSLVAVKA YYGGLLVGYA LSTLKQHIPN       180
     VETRVAAIYR QGKAIKPLGT TIIEADDEVF FIAATKHIRA VMNELQRLER SYKNIMIAGG       240
     GNIGAGLARS LEKNHSVKLI ERSKERAEQL SEMLDNTIVF CGDASDQELL SEEHIDQVDV       300
     FIAVTNDDEV NIMSAMLAKR MGAQKTMVLI QRSAYVDLVQ GGDIDIAISP QEATISALLT       360
     HVRRGDIVNV YSLRKGAAEA IEAVAHGDEN TSKVVGRTVR DIKLPAGTTI GAVVRNDDVL       420
     IAHDDTIIMS GDHVIMFLID KKHINIVEKL FQVSAIFL                               458
//

If you have problems or comments...

PBIL Back to PBIL home page