(data stored in ACNUC7421 zone)

EMBL: CR954246.TRKH

CR954246.TRKH        Location/Qualifiers
FT   CDS             19070..20521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="PSHAa0015"
FT                   /product="potassium transport protein, requires TrkE (Trk
FT                   family)"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85129"
FT                   /db_xref="GOA:Q3IJ19"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ19"
FT                   /protein_id="CAI85129.1"
FT                   /translation="MQFRTIIKILGQLVALFSITMVPPAIVSLIYKDGGGVPFVLAFIF
FT                   SVTIGLMAYYPNRHEDGDLKAREGFLIVVLFWLVLGAFASLPLIFLQEPNLSLADAVFE
FT                   AFSGLTTTGATVLTGIEYLPKSVLFYRQQLQWFGGMGIIVLAVAILPMLGVGGMQLYRA
FT                   EIPGPVKDSKMTPRIADTAKHLWYIYVSITLACTLAYWIAGMDWFDAISHAFSTVAIGG
FT                   FSTYDASMGHFDSPVINFICVFFLIIAAINFSLHYAAVASRNISVYIRDPEFKVFLCIQ
FT                   LALVVICFTVLSSHEVYANGDETLDQALFHAVSISSTAGFATDNFSAWPLFLPILLIFS
FT                   SFIGGCAGSTGGGMKVVRVFLLYLQGVRELNRLVHPRAIYSIKLGSKALPDKVVEAVWG
FT                   FFSAYALVFIIIMLALMGTGMDNITAFSATAACLNNLGPGLGDVASHYGSISDGAKWLL
FT                   TIAMVFGRLEIFTLLVLFTPTFWRG"
     MQFRTIIKIL GQLVALFSIT MVPPAIVSLI YKDGGGVPFV LAFIFSVTIG LMAYYPNRHE        60
     DGDLKAREGF LIVVLFWLVL GAFASLPLIF LQEPNLSLAD AVFEAFSGLT TTGATVLTGI       120
     EYLPKSVLFY RQQLQWFGGM GIIVLAVAIL PMLGVGGMQL YRAEIPGPVK DSKMTPRIAD       180
     TAKHLWYIYV SITLACTLAY WIAGMDWFDA ISHAFSTVAI GGFSTYDASM GHFDSPVINF       240
     ICVFFLIIAA INFSLHYAAV ASRNISVYIR DPEFKVFLCI QLALVVICFT VLSSHEVYAN       300
     GDETLDQALF HAVSISSTAG FATDNFSAWP LFLPILLIFS SFIGGCAGST GGGMKVVRVF       360
     LLYLQGVREL NRLVHPRAIY SIKLGSKALP DKVVEAVWGF FSAYALVFII IMLALMGTGM       420
     DNITAFSATA ACLNNLGPGL GDVASHYGSI SDGAKWLLTI AMVFGRLEIF TLLVLFTPTF       480
     WRG                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page