(data stored in ACNUC7421 zone)

EMBL: CR954246.TRMA

CR954246.TRMA        Location/Qualifiers
FT   CDS             complement(261601..262704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="PSHAa0250"
FT                   /product="tRNA (Uracil-5-)-methyltransferase
FT                   (tRNA(M-5-U54)-methyltransferase) (RUMT)"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.1.1.35"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1999392, 1447162; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85353"
FT                   /db_xref="GOA:Q3ILM2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILM2"
FT                   /protein_id="CAI85353.1"
FT                   /translation="MAVIKIDTSQYDAQLSEKEQRIAAQFQRFGVDKLEVFSSEPINYR
FT                   QRAEFRVWHDGDDLFHIMFDQQTKDKIRVDSFDPAAPLVGEVMQVMIDNLKSCEILRRK
FT                   LFQIDYLSTLSGEILVSLLYHKPLDEHWLSEINTLKEKLSSKYKIDFIGRARKQKEMLG
FT                   DDYVTERLNVNGQELIYQQVENSFTQPNAKVNIKMLEWAQDLCKPLKNDLLELYCGNGN
FT                   FSIALAGSFNKVLATEISKSSVHSAQYNIAQNKVDNLDIIRMSSEEFTQAMNGERSFSR
FT                   LEGIDLNSYNCQTILVDPPRAGMDTLTCDLVANYESIIYISCNPETLERDLDHLTRTHE
FT                   VKRFAIFDQFPYTHHIESGVFLQKKNT"
     MAVIKIDTSQ YDAQLSEKEQ RIAAQFQRFG VDKLEVFSSE PINYRQRAEF RVWHDGDDLF        60
     HIMFDQQTKD KIRVDSFDPA APLVGEVMQV MIDNLKSCEI LRRKLFQIDY LSTLSGEILV       120
     SLLYHKPLDE HWLSEINTLK EKLSSKYKID FIGRARKQKE MLGDDYVTER LNVNGQELIY       180
     QQVENSFTQP NAKVNIKMLE WAQDLCKPLK NDLLELYCGN GNFSIALAGS FNKVLATEIS       240
     KSSVHSAQYN IAQNKVDNLD IIRMSSEEFT QAMNGERSFS RLEGIDLNSY NCQTILVDPP       300
     RAGMDTLTCD LVANYESIIY ISCNPETLER DLDHLTRTHE VKRFAIFDQF PYTHHIESGV       360
     FLQKKNT                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page