(data stored in ACNUC7421 zone)

EMBL: CR954246.TRXA

CR954246.TRXA        Location/Qualifiers
FT   CDS             complement(120291..120617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="PSHAa0113"
FT                   /product="thioredoxin 1, redox factor"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85222"
FT                   /db_xref="GOA:Q3IDJ0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ0"
FT                   /protein_id="CAI85222.1"
FT                   /translation="MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSE
FT                   VAEEFDGRVTIAKLNIDQNAGTPPKFGIRGIPTLLLFKDGQVAATKVGALSKTQLIEFL
FT                   ENNL"
     MSEKIIQITD DSFEADVLQS DKPVLVDFWA EWCGPCKMIA PILSEVAEEF DGRVTIAKLN        60
     IDQNAGTPPK FGIRGIPTLL LFKDGQVAAT KVGALSKTQL IEFLENNL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page