(data stored in ACNUC7421 zone)

EMBL: CR954246.TUFA

CR954246.TUFA        Location/Qualifiers
FT   CDS             239981..241165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="PSHAa0227"
FT                   /product="protein chain elongation factor EF-Tu;
FT                   GTP-binding factor"
FT                   /function="3 : Information transfer pathways"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /function="3.3.4 : Elongation"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85330"
FT                   /db_xref="GOA:Q3ILP4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP4"
FT                   /protein_id="CAI85330.1"
FT                   /translation="MAKAKFERVKPHVNVGTIGHVDHGKTTLTAAITNVLAKVYGGVAK
FT                   DFASIDNAPEERERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPLIQGSALKALEGEKEWEDKIVELANALDSYIPEPQRDIDKPFIMPIEDVFSIQ
FT                   GRGTVVTGRVEAGIIRINDEIEIVGIRDTTKSICTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREDVERGQVLAKPGSIKPHTTFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   DVQLPEGVEMVMPGDNVKMTVTLIAPIAMDEGLRFAIREGGRTVGAGVVANIVA"
     MAKAKFERVK PHVNVGTIGH VDHGKTTLTA AITNVLAKVY GGVAKDFASI DNAPEERERG        60
     ITISTSHVEY DTPTRHYAHV DCPGHADYVK NMITGAAQMD GAILVVAATD GPMPQTREHI       120
     LLSRQVGVPY IIVFMNKCDM VDDEELLELV EMEVRELLSE YDFPGDDLPL IQGSALKALE       180
     GEKEWEDKIV ELANALDSYI PEPQRDIDKP FIMPIEDVFS IQGRGTVVTG RVEAGIIRIN       240
     DEIEIVGIRD TTKSICTGVE MFRKLLDEGR AGENIGALLR GTKREDVERG QVLAKPGSIK       300
     PHTTFESEVY VLSKDEGGRH TPFFKGYRPQ FYFRTTDVTG DVQLPEGVEM VMPGDNVKMT       360
     VTLIAPIAMD EGLRFAIREG GRTVGAGVVA NIVA                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page