(data stored in ACNUC7421 zone)

EMBL: CR954246.TYPA

CR954246.TYPA        Location/Qualifiers
FT   CDS             176578..178401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PSHAa0167"
FT                   /product="GTP-binding protein TypA/BipA (Tyrosine
FT                   phosphorylated protein A); involved in LPS core synthesis"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12654836, 12675808; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85271"
FT                   /db_xref="GOA:Q3IFK9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFK9"
FT                   /protein_id="CAI85271.1"
FT                   /translation="MSIEKIRNIAIIAHVDHGKTTLVDKLLEFSGTLETRGGNEERVMD
FT                   SNDIERERGITILAKNTAISWNGYHINIVDTPGHADFGGEVERVLSMADSVLLIVDAQE
FT                   GPMPQTRFVTQKAFAQGLKPIVVINKIDKPSARPDWVMDQIFDLFDNLGATDEQLDFKV
FT                   IYASAINGWATLDLDEPSDNMDAMFQMIVDEVSPPDADPEGDFQMQISQLDYNSYVGVI
FT                   GVGRIKRGSVAPNQQVTIISADGTKRNGKIGTVQSYLGLDRIETDRGYAGNIVTVTGIG
FT                   ELKISDTVCCPTNVEALPPLSVDEPTVTMTFSVNNSPFCGKEGKFVTSRNIRERLDKEL
FT                   VHNVALRVEDTASPDSFRVSGRGELHLGILIENMRREGYELAVSRPEVILRTVDGVLEE
FT                   PFETVTIDCQEEHQGSVMEQVGLRKGELTNMSPDGKGRMRLDFIIPSRGLIGFQTDFMT
FT                   LTSGSGLMYHTFDHYGPHKGGSIGVRKNGVIIANATGKALTNALFNLQERGRLFIGHGV
FT                   EVYEGMVIGIHNRDNDLTVNALKGKQLTNVRASGTDEAQTLSPPLNYSLEQALEFIDED
FT                   ELVEVTPLNIRIRKRHLTENERKRAGRAPKS"
     MSIEKIRNIA IIAHVDHGKT TLVDKLLEFS GTLETRGGNE ERVMDSNDIE RERGITILAK        60
     NTAISWNGYH INIVDTPGHA DFGGEVERVL SMADSVLLIV DAQEGPMPQT RFVTQKAFAQ       120
     GLKPIVVINK IDKPSARPDW VMDQIFDLFD NLGATDEQLD FKVIYASAIN GWATLDLDEP       180
     SDNMDAMFQM IVDEVSPPDA DPEGDFQMQI SQLDYNSYVG VIGVGRIKRG SVAPNQQVTI       240
     ISADGTKRNG KIGTVQSYLG LDRIETDRGY AGNIVTVTGI GELKISDTVC CPTNVEALPP       300
     LSVDEPTVTM TFSVNNSPFC GKEGKFVTSR NIRERLDKEL VHNVALRVED TASPDSFRVS       360
     GRGELHLGIL IENMRREGYE LAVSRPEVIL RTVDGVLEEP FETVTIDCQE EHQGSVMEQV       420
     GLRKGELTNM SPDGKGRMRL DFIIPSRGLI GFQTDFMTLT SGSGLMYHTF DHYGPHKGGS       480
     IGVRKNGVII ANATGKALTN ALFNLQERGR LFIGHGVEVY EGMVIGIHNR DNDLTVNALK       540
     GKQLTNVRAS GTDEAQTLSP PLNYSLEQAL EFIDEDELVE VTPLNIRIRK RHLTENERKR       600
     AGRAPKS                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page