(data stored in ACNUC7421 zone)

EMBL: CR954246.TYRZ

CR954246.TYRZ        Location/Qualifiers
FT   CDS             559119..560318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrZ"
FT                   /locus_tag="PSHAa0545"
FT                   /product="Tyrosyl-tRNA synthetase II"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12572618, 11834741; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85633"
FT                   /db_xref="GOA:Q3ILJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ9"
FT                   /protein_id="CAI85633.1"
FT                   /translation="MDLQTALAEIKRGTEEILIEDELVEKLKSGKKLKIKAGFDPTAPD
FT                   LHLGHTVLINKMKTFQDLGHEVVFLIGDFTGMIGDPTGKNVTRKPLTREDVLANAETYK
FT                   EQVFKILDPAKTTVAFNSTWMENLGAAGMIKLAARQTVARMLERDDFKKRYASGQSIAI
FT                   HEFLYPLVQGWDSVALEADVELGGTDQRFNLLMGRELQKDEGQKPQTVIMTPLLEGTDG
FT                   VQKMSKSLGNYIGITDAPNDMFGKIMSISDVLMWRYYDLLSGLSIAGINAQKERVEQGT
FT                   NPRDIKIELAKELIARFHSEADAQAAHDDFIQRFQKKALPDEIPELTVTIEQDSILIAN
FT                   LLKEANLVASTSEAMRMIKQGAVKLNGEDKITDTKLEIAKGSTAIYQVGKRKFANITVA
FT                   "
     MDLQTALAEI KRGTEEILIE DELVEKLKSG KKLKIKAGFD PTAPDLHLGH TVLINKMKTF        60
     QDLGHEVVFL IGDFTGMIGD PTGKNVTRKP LTREDVLANA ETYKEQVFKI LDPAKTTVAF       120
     NSTWMENLGA AGMIKLAARQ TVARMLERDD FKKRYASGQS IAIHEFLYPL VQGWDSVALE       180
     ADVELGGTDQ RFNLLMGREL QKDEGQKPQT VIMTPLLEGT DGVQKMSKSL GNYIGITDAP       240
     NDMFGKIMSI SDVLMWRYYD LLSGLSIAGI NAQKERVEQG TNPRDIKIEL AKELIARFHS       300
     EADAQAAHDD FIQRFQKKAL PDEIPELTVT IEQDSILIAN LLKEANLVAS TSEAMRMIKQ       360
     GAVKLNGEDK ITDTKLEIAK GSTAIYQVGK RKFANITVA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page