(data stored in ACNUC7421 zone)

EMBL: CR954246.UBID

CR954246.UBID        Location/Qualifiers
FT   CDS             complement(108538..110004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="PSHAa0105"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxylyase;
FT                   ubiquinone biosynthesis, third step"
FT                   /function="1.4 : Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /function="2.5.4 : Menaquinone and ubiquinone"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9658014, 11029449; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85214"
FT                   /db_xref="GOA:Q3IDJ8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDJ8"
FT                   /protein_id="CAI85214.1"
FT                   /translation="MKYKDLRDFIDLLEKRGELKRITQEIDPYLEMTEIADRTLRAKGP
FT                   ALLFENPKGYDIPVLANLFGTPKRVAMGMGQEDVSELREVGKLLAFLKEPEPPKGIKEA
FT                   LGQIPVYKQVLNMPAKEVKKAPCQEVILQGDEVDLTKLPIQHCWPGDAAPLITWGLTVT
FT                   KGPYKKRQNLGIYRQQLLGKNKIIMRWLSHRGGALDFQEWCKENPGQPYPVSVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSKTEVVKSISNDLQVPASAEIVLEGYIMPGEMAP
FT                   EGPYGDHTGYYNEVDDFPVMTVTHMTHRKNPIYHSTFTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAIVTMKKQYPGHAKRVMMGVWSYLRQFMYTKFVIVCD
FT                   DDINARDWEDVIWAITTRMDPARDTTLIENTPIDYLDFASPVSGLGSKMGMDATNKWPG
FT                   ETNREWGEPIEMDKATKDRVDDIWQSLNIL"
     MKYKDLRDFI DLLEKRGELK RITQEIDPYL EMTEIADRTL RAKGPALLFE NPKGYDIPVL        60
     ANLFGTPKRV AMGMGQEDVS ELREVGKLLA FLKEPEPPKG IKEALGQIPV YKQVLNMPAK       120
     EVKKAPCQEV ILQGDEVDLT KLPIQHCWPG DAAPLITWGL TVTKGPYKKR QNLGIYRQQL       180
     LGKNKIIMRW LSHRGGALDF QEWCKENPGQ PYPVSVALGA DPATILGAVT PVPDTLSEYA       240
     FAGLLRGSKT EVVKSISNDL QVPASAEIVL EGYIMPGEMA PEGPYGDHTG YYNEVDDFPV       300
     MTVTHMTHRK NPIYHSTFTG RPPDEPAILG VALNEVFVPI LQKQFPEIVD FYLPPEGCSY       360
     RMAIVTMKKQ YPGHAKRVMM GVWSYLRQFM YTKFVIVCDD DINARDWEDV IWAITTRMDP       420
     ARDTTLIENT PIDYLDFASP VSGLGSKMGM DATNKWPGET NREWGEPIEM DKATKDRVDD       480
     IWQSLNIL                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page