(data stored in ACNUC7421 zone)

EMBL: CR954246.UBIH

CR954246.UBIH        Location/Qualifiers
FT   CDS             583881..585071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="PSHAa0563"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /function="2.5.4 : Menaquinone and ubiquinone"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1339425; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85650"
FT                   /db_xref="GOA:Q3ILI3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI3"
FT                   /protein_id="CAI85650.1"
FT                   /translation="MPKQFDVVVIGGGLAGASCALSVAKINPALSIAVVEANEVSNDYH
FT                   PSFDDRSIALAQQSVEYLQGLNLFALNSPYATAIKKVSVSDRHHFGKADINCEEFAKDA
FT                   LGYVVEVNPFGRSLHQLLNAQINISLYCPDSVSAIEQQLHNNIVTLQSGEQIAAKLLVI
FT                   ADGAQSPTRSLFGLKFNTQAYKQGAIIANIEVAGGHNNHAFERFTQHGPMALLPMSNNR
FT                   YSLVWCMQQQHVEQHMAQSEDDFISALQSAFGYRGGQFTKVGMRANYPLVYGQVESLIA
FT                   HRTVVIGNAAHAIHPIAGQGFNLGLRDVQVLSNLISQSPNDLGSYAFTREYAQQRSADI
FT                   NNVMTLTDGLVRLFSNSSRILALGRSIGLFSMDLFPSLKAPLAKQLMGQVKQGQGL"
     MPKQFDVVVI GGGLAGASCA LSVAKINPAL SIAVVEANEV SNDYHPSFDD RSIALAQQSV        60
     EYLQGLNLFA LNSPYATAIK KVSVSDRHHF GKADINCEEF AKDALGYVVE VNPFGRSLHQ       120
     LLNAQINISL YCPDSVSAIE QQLHNNIVTL QSGEQIAAKL LVIADGAQSP TRSLFGLKFN       180
     TQAYKQGAII ANIEVAGGHN NHAFERFTQH GPMALLPMSN NRYSLVWCMQ QQHVEQHMAQ       240
     SEDDFISALQ SAFGYRGGQF TKVGMRANYP LVYGQVESLI AHRTVVIGNA AHAIHPIAGQ       300
     GFNLGLRDVQ VLSNLISQSP NDLGSYAFTR EYAQQRSADI NNVMTLTDGL VRLFSNSSRI       360
     LALGRSIGLF SMDLFPSLKA PLAKQLMGQV KQGQGL                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page