(data stored in ACNUC7421 zone)

EMBL: CR954246.UGD

CR954246.UGD         Location/Qualifiers
FT   CDS             464254..465420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="PSHAa0444"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9383197; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85541"
FT                   /db_xref="GOA:Q3IEI5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI5"
FT                   /protein_id="CAI85541.1"
FT                   /translation="MKVTVVGTGYVGLSNAMLLAQHNEVIALDIDEQKIALLNNKQSPI
FT                   VDFHISEYLQRDDISFTATTNKSMAYCNADFIIIATPTDYDTHTHNFNTSSVEAVINDA
FT                   LAYNPHAVIIVKSTVPVRFTQRMKAQLGVDNIIFSPEFLREGKALYDNLHPSRIVVGEQ
FT                   SERAAVFANLLKQGAIKQDIAVLFTESTEAEAIKLFSNTYLAMRVAYFNELDTYAEAHG
FT                   LNSKQIIQGVGLDPRIGNHYNNPSFGYGGYCLPKDTKQLLANYKDIPNNMICAIVDANT
FT                   TRKNFIADSIIKRNPKVVGIYRLVMKTGSDNFRASAIQGIMKRIAASNVQMVVYEPELK
FT                   EDVFYNSRVIRNLNEFKQISDVVVSNRMVEELSDITDKVYTRDLFGSD"
     MKVTVVGTGY VGLSNAMLLA QHNEVIALDI DEQKIALLNN KQSPIVDFHI SEYLQRDDIS        60
     FTATTNKSMA YCNADFIIIA TPTDYDTHTH NFNTSSVEAV INDALAYNPH AVIIVKSTVP       120
     VRFTQRMKAQ LGVDNIIFSP EFLREGKALY DNLHPSRIVV GEQSERAAVF ANLLKQGAIK       180
     QDIAVLFTES TEAEAIKLFS NTYLAMRVAY FNELDTYAEA HGLNSKQIIQ GVGLDPRIGN       240
     HYNNPSFGYG GYCLPKDTKQ LLANYKDIPN NMICAIVDAN TTRKNFIADS IIKRNPKVVG       300
     IYRLVMKTGS DNFRASAIQG IMKRIAASNV QMVVYEPELK EDVFYNSRVI RNLNEFKQIS       360
     DVVVSNRMVE ELSDITDKVY TRDLFGSD                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page