(data stored in ACNUC7421 zone)

EMBL: CR954246.UVRD

CR954246.UVRD        Location/Qualifiers
FT   CDS             complement(131383..133548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="PSHAa0122"
FT                   /product="DNA-dependent ATPase I and helicase II; highly
FT                   similar to PSHA_1_2804"
FT                   /function="3.1.1 : DNA replication"
FT                   /function="3.1.2 : DNA recombination"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12527299, 12788954; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85226"
FT                   /db_xref="GOA:Q3IDF8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF8"
FT                   /protein_id="CAI85226.1"
FT                   /translation="MDVSQLLDGLNDKQRDAVAAPLQNMLVLAGAGSGKTRVLVHRIAW
FT                   LMQVEQASTYSIFAVTFTNKAAKEMRTRVEETLKAPVGGMWIGTFHGLSHRILRAHHRE
FT                   AKLPEAFQILDSDDQLRMIKRLLKSMNIDDKKWPAKQFGWYISAKKDEALRPKDIQAYD
FT                   INEQMMLRVYAAYQEACDRAGLVDFAEILLRSYEVLKNNPTLLRHYQQRFAHMLVDEFQ
FT                   DTNTIQYAWLKLLAGDSNSIMIVGDDDQSIYGWRGAKIENIKRFLTDFSAETIRLEQNY
FT                   RSTATILKASNALIQNNSERMGKSLWTDGNEGEPISIYAAFNELDEARFVSSKLRSWLN
FT                   AGNALQDAAILYRSNAQSRVLEEAMLQEGLKYRIYGGMRFFERQEIKDALSYLRIIGNR
FT                   QDDAAFERVINTPARGIGDKTLSHIRDCARAESLPLWYAAKAIVEQQHLSGRASGAVSK
FT                   FVELVEHIEDKISDLTLHEQAKYVIQTSGLMAMYQAEKGEKGRARVENLEELISACDQY
FT                   ELPEEEEYSSPLQGFLAHTSLESGEGQAEEHEDAVQMMTLHSAKGLEFPLVFMVGVEEG
FT                   MFPSQQSNEESGRLEEERRLCYVGMTRAMDKLYISHAESRRLYGQEKYHTPSRFLREIP
FT                   EDCVEEIRIKTQVSRPPAAGRFSASVSHAAFEDSGFNLGQRVLHAKFGIGTVLNYEGAG
FT                   AQSRVQVNFDDLGSKWLVTAYARLQAI"
     MDVSQLLDGL NDKQRDAVAA PLQNMLVLAG AGSGKTRVLV HRIAWLMQVE QASTYSIFAV        60
     TFTNKAAKEM RTRVEETLKA PVGGMWIGTF HGLSHRILRA HHREAKLPEA FQILDSDDQL       120
     RMIKRLLKSM NIDDKKWPAK QFGWYISAKK DEALRPKDIQ AYDINEQMML RVYAAYQEAC       180
     DRAGLVDFAE ILLRSYEVLK NNPTLLRHYQ QRFAHMLVDE FQDTNTIQYA WLKLLAGDSN       240
     SIMIVGDDDQ SIYGWRGAKI ENIKRFLTDF SAETIRLEQN YRSTATILKA SNALIQNNSE       300
     RMGKSLWTDG NEGEPISIYA AFNELDEARF VSSKLRSWLN AGNALQDAAI LYRSNAQSRV       360
     LEEAMLQEGL KYRIYGGMRF FERQEIKDAL SYLRIIGNRQ DDAAFERVIN TPARGIGDKT       420
     LSHIRDCARA ESLPLWYAAK AIVEQQHLSG RASGAVSKFV ELVEHIEDKI SDLTLHEQAK       480
     YVIQTSGLMA MYQAEKGEKG RARVENLEEL ISACDQYELP EEEEYSSPLQ GFLAHTSLES       540
     GEGQAEEHED AVQMMTLHSA KGLEFPLVFM VGVEEGMFPS QQSNEESGRL EEERRLCYVG       600
     MTRAMDKLYI SHAESRRLYG QEKYHTPSRF LREIPEDCVE EIRIKTQVSR PPAAGRFSAS       660
     VSHAAFEDSG FNLGQRVLHA KFGIGTVLNY EGAGAQSRVQ VNFDDLGSKW LVTAYARLQA       720
     I                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page