(data stored in ACNUC7421 zone)

EMBL: CR954246.VISC

CR954246.VISC        Location/Qualifiers
FT   CDS             585068..586234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="PSHAa0564"
FT                   /product="putative monooxygenase, FAD/NAD(P)-binding
FT                   domain"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85651"
FT                   /db_xref="GOA:Q3ILI2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI2"
FT                   /protein_id="CAI85651.1"
FT                   /translation="MKQAQVCIVGGGSVGLTLALGLAKAGISVVVLDAAPKQTPPTDEY
FT                   GMRVSALSIASQTLLEQLNVWPHIVALRASAYTHMDVRDADSFGKIAFNSEQLELDHLG
FT                   HIVENDIICYALIKELEQQPNATLMFDTCYQQIHQSESDVFVTLKSGEPIIAKLLVAAD
FT                   GANSAIRKQFNMALSFKDYDHHALVATVKTQEPHANTARQVFLPSGPLAFLPLSDANTH
FT                   SIVWSTNPTHCEELLAMDDNQFNKAIMAAIDGQCGLCEVQSVRAAFPLKMRYAQQWVAG
FT                   KVVLIGDAAHTIHPLAGLGMNLGLKDAAYLIELLTSDNKEFASTRTLRDYERTRKLDAQ
FT                   KHIAMMYSLKELFAGANPIKKLIRGVGLSMVDNLGPIKHLFAKEAIGK"
     MKQAQVCIVG GGSVGLTLAL GLAKAGISVV VLDAAPKQTP PTDEYGMRVS ALSIASQTLL        60
     EQLNVWPHIV ALRASAYTHM DVRDADSFGK IAFNSEQLEL DHLGHIVEND IICYALIKEL       120
     EQQPNATLMF DTCYQQIHQS ESDVFVTLKS GEPIIAKLLV AADGANSAIR KQFNMALSFK       180
     DYDHHALVAT VKTQEPHANT ARQVFLPSGP LAFLPLSDAN THSIVWSTNP THCEELLAMD       240
     DNQFNKAIMA AIDGQCGLCE VQSVRAAFPL KMRYAQQWVA GKVVLIGDAA HTIHPLAGLG       300
     MNLGLKDAAY LIELLTSDNK EFASTRTLRD YERTRKLDAQ KHIAMMYSLK ELFAGANPIK       360
     KLIRGVGLSM VDNLGPIKHL FAKEAIGK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page