(data stored in ACNUC7421 zone)

EMBL: CR954246.XERC

CR954246.XERC        Location/Qualifiers
FT   CDS             complement(93298..94245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="PSHAa0090"
FT                   /product="site-specific recombinase"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10760161; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85199"
FT                   /db_xref="GOA:Q3IDS2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS2"
FT                   /protein_id="CAI85199.1"
FT                   /translation="MSDNPAPNISDLSDNWRTPITLFSDYLKFERQYSAHTVNQYVSQL
FT                   GFAALYFSKLCDDWFSVQGEHIRRYSMALRSKQLSGRTISLKLSCIRSLYKFLKAKNIA
FT                   KQAHYHNPAVGIKGPKFAKPLPKNLDVDQMARLLEIPDDEPLAIRDKAMMELMYSSGLR
FT                   ISELVGANLQDISAANGEILVRGKGNKERLIPVGSKALNALKKWLIIRPQFANPDEVAV
FT                   FLSSKKNRISVRQVRLRMQEWGIKQGISSQVHPHKLRHSFASHILESSGDLRAVQELLG
FT                   HSSLSATQVYTHLDFQHLAKVYDNTHPRAKKRTD"
     MSDNPAPNIS DLSDNWRTPI TLFSDYLKFE RQYSAHTVNQ YVSQLGFAAL YFSKLCDDWF        60
     SVQGEHIRRY SMALRSKQLS GRTISLKLSC IRSLYKFLKA KNIAKQAHYH NPAVGIKGPK       120
     FAKPLPKNLD VDQMARLLEI PDDEPLAIRD KAMMELMYSS GLRISELVGA NLQDISAANG       180
     EILVRGKGNK ERLIPVGSKA LNALKKWLII RPQFANPDEV AVFLSSKKNR ISVRQVRLRM       240
     QEWGIKQGIS SQVHPHKLRH SFASHILESS GDLRAVQELL GHSSLSATQV YTHLDFQHLA       300
     KVYDNTHPRA KKRTD                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page