(data stored in ACNUC7421 zone)

EMBL: CR954246.XERD

CR954246.XERD        Location/Qualifiers
FT   CDS             527888..528814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="PSHAa0514"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /function="3.1.2 : DNA recombination"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85604"
FT                   /db_xref="GOA:Q3ILE1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE1"
FT                   /protein_id="CAI85604.1"
FT                   /translation="MTTLADDFSEPSTAPKSNNDYLETFLDCLYLEQGVSENTLSAYRS
FT                   DLDKFCQFLKGKNLMTVTGLDVESYLAHRVDLGLKPRSTARSISALKRFYQYFVREKLI
FT                   SDSPMLNIAQPKAGQSLPKTLSEAEVEALLSAPNTDEPMGLRDKAMLELLYATGLRVSE
FT                   LVGLRIEQINLRQAVVFVKGKGNKERLVPLGEEAMYWLEQFLKVGRAQMIKHATDFVFP
FT                   SKRGVGMTRQTFWHRVKHYAILASIESSLSPHTLRHAFATHLLNHGADLRVVQMMLGHS
FT                   DLSTTQIYTHVANERLKSVHAQHHPRA"
     MTTLADDFSE PSTAPKSNND YLETFLDCLY LEQGVSENTL SAYRSDLDKF CQFLKGKNLM        60
     TVTGLDVESY LAHRVDLGLK PRSTARSISA LKRFYQYFVR EKLISDSPML NIAQPKAGQS       120
     LPKTLSEAEV EALLSAPNTD EPMGLRDKAM LELLYATGLR VSELVGLRIE QINLRQAVVF       180
     VKGKGNKERL VPLGEEAMYW LEQFLKVGRA QMIKHATDFV FPSKRGVGMT RQTFWHRVKH       240
     YAILASIESS LSPHTLRHAF ATHLLNHGAD LRVVQMMLGH SDLSTTQIYT HVANERLKSV       300
     HAQHHPRA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page