(data stored in ACNUC7421 zone)

EMBL: CR954246.YAJC

CR954246.YAJC        Location/Qualifiers
FT   CDS             335876..336211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="PSHAa0320"
FT                   /product="putative preprotein translocase IISP family,
FT                   membrane subunit"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12068816; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85419"
FT                   /db_xref="GOA:Q3ILB7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB7"
FT                   /protein_id="CAI85419.1"
FT                   /translation="MSLFISNAHASTGSASAGGGMEMLIMLAIFGLVFYFLIYRPQAKR
FT                   VKEHKSLMSAMAKGDEVLTQGGLVGKIVKIADDKDFVVISLNEQAEVTVQKSAVTAVLP
FT                   KGTMKSL"
     MSLFISNAHA STGSASAGGG MEMLIMLAIF GLVFYFLIYR PQAKRVKEHK SLMSAMAKGD        60
     EVLTQGGLVG KIVKIADDKD FVVISLNEQA EVTVQKSAVT AVLPKGTMKS L                111
//

If you have problems or comments...

PBIL Back to PBIL home page