(data stored in ACNUC7421 zone)

EMBL: CR954246.YGGH

CR954246.YGGH        Location/Qualifiers
FT   CDS             complement(568935..569660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggH"
FT                   /locus_tag="PSHAa0553"
FT                   /product="tRNA (m7G46) methyltransferase, SAM-dependent"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.1.1.33"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730187; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85641"
FT                   /db_xref="GOA:Q3ILJ1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ1"
FT                   /protein_id="CAI85641.1"
FT                   /translation="MSESSNTNLEQAKQEGKYIRTIRSFVKREGRLTKGQAAAIEKCWP
FT                   IMGLEHKNGMLDLSEVFGNNNDVVLEIGFGMGKSLVEMAKNAPHLNFIGIEVHRPGVGA
FT                   CLMDADEAGITNLRIFEHDAVEVLADCIADESLTTLQLFFPDPWHKKRHHKRRIVQGEF
FT                   VEKLRSQLKMGGVFHMATDWENYAEHMLEVMQAAPGFKNQSTTNDYVPRPDLRPLTKFE
FT                   QRGHRLGHGVWDLMFERTK"
     MSESSNTNLE QAKQEGKYIR TIRSFVKREG RLTKGQAAAI EKCWPIMGLE HKNGMLDLSE        60
     VFGNNNDVVL EIGFGMGKSL VEMAKNAPHL NFIGIEVHRP GVGACLMDAD EAGITNLRIF       120
     EHDAVEVLAD CIADESLTTL QLFFPDPWHK KRHHKRRIVQ GEFVEKLRSQ LKMGGVFHMA       180
     TDWENYAEHM LEVMQAAPGF KNQSTTNDYV PRPDLRPLTK FEQRGHRLGH GVWDLMFERT       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page