(data stored in ACNUC7421 zone)

EMBL: CR954246.YIFB

CR954246.YIFB        Location/Qualifiers
FT   CDS             139196..140707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifB"
FT                   /locus_tag="PSHAa0130"
FT                   /product="putative regulator"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85234"
FT                   /db_xref="GOA:Q3IDF6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF6"
FT                   /protein_id="CAI85234.1"
FT                   /translation="MSLARIYSRAQVGINAPEVIVEVHLGNGLPAFHIVGLPEASVKES
FT                   KDRVRSALENSKFGFPDQRITVNLAPADLPKDGGRFDLAIAVGILVASGQIVCSDIHKY
FT                   EFYGELALNGEIRGVNAILPSVLAAKEQDRCCFLPLANDSLASLVNGVKRKAVSSIAEV
FT                   WGDLLNQQPLPLNIQYPDCTQAPDFLLDLSDVKGQPGAKRVLEIAAAGGHNLLFLGPPG
FT                   TGKSMLAQRMATIMPTMSDDEAIATAALYSIIGQSIDLTNWRQRPFRNPHHTCSAVALV
FT                   GGSSNPKPGEISLAHNGVLFLDELPEFERKVLDSLREPMETGTVTISRVARQMEFPAQF
FT                   QLITALNPSPTGCHNDKRATPDQVMRYLSRVSGPFIDRIDLQIELPRLTSVELQSSKPE
FT                   ETSAVVRARVEAAYYLQLKRQGKVNARLNNKEMSIHCDLASTELQFLARASEKLALSPR
FT                   SYHRIIKVARTISDLKGAERISLDELKEALNYRAFERLLAQLTKY"
     MSLARIYSRA QVGINAPEVI VEVHLGNGLP AFHIVGLPEA SVKESKDRVR SALENSKFGF        60
     PDQRITVNLA PADLPKDGGR FDLAIAVGIL VASGQIVCSD IHKYEFYGEL ALNGEIRGVN       120
     AILPSVLAAK EQDRCCFLPL ANDSLASLVN GVKRKAVSSI AEVWGDLLNQ QPLPLNIQYP       180
     DCTQAPDFLL DLSDVKGQPG AKRVLEIAAA GGHNLLFLGP PGTGKSMLAQ RMATIMPTMS       240
     DDEAIATAAL YSIIGQSIDL TNWRQRPFRN PHHTCSAVAL VGGSSNPKPG EISLAHNGVL       300
     FLDELPEFER KVLDSLREPM ETGTVTISRV ARQMEFPAQF QLITALNPSP TGCHNDKRAT       360
     PDQVMRYLSR VSGPFIDRID LQIELPRLTS VELQSSKPEE TSAVVRARVE AAYYLQLKRQ       420
     GKVNARLNNK EMSIHCDLAS TELQFLARAS EKLALSPRSY HRIIKVARTI SDLKGAERIS       480
     LDELKEALNY RAFERLLAQL TKY                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page