(data stored in ACNUC7421 zone)

EMBL: CR954246.ZUR

CR954246.ZUR         Location/Qualifiers
FT   CDS             complement(508433..508870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="PSHAa0493"
FT                   /product="Zinc uptake regulation protein"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9680209; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85588"
FT                   /db_xref="GOA:Q3IG93"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG93"
FT                   /protein_id="CAI85588.1"
FT                   /translation="MNIESLVSKAKQVCDNRGARFTPIREKVFRLLASAQGGVGAYDLL
FT                   EQLKVTETGAKPATIYRALDFLAELGFIHKIESTNAFMLCHHFDHIHPVQLLICDTCGF
FT                   VKELHSTVISHELNSLAAEGGFVVSAQTIEAHGRCESCRAA"
     MNIESLVSKA KQVCDNRGAR FTPIREKVFR LLASAQGGVG AYDLLEQLKV TETGAKPATI        60
     YRALDFLAEL GFIHKIESTN AFMLCHHFDH IHPVQLLICD TCGFVKELHS TVISHELNSL       120
     AAEGGFVVSA QTIEAHGRCE SCRAA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page