(data stored in ACNUC29543 zone)

EMBL: CT978603.AAT

CT978603.AAT         Location/Qualifiers
FT   CDS             complement(481544..482152)
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="SynRCC307_0544"
FT                   /product="Leu/Phe-tRNA-protein transferase"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27447"
FT                   /db_xref="GOA:A5GRD8"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD8"
FT                   /protein_id="CAK27447.1"
FT                   /translation="MNDLLAAYAAGWFPMAEGPDRALGLFRARNRALIPLDQRFHVPRS
FT                   LRRQLRPGRFELKLNSAFAAVVDGCADRPSTWISLELRAIYQELHRLGWAHSIEAWDAH
FT                   GLAGGQLGLAIGRCWIGESMFHSRPHASNVVLVQLQSALRQGGFELFDVQLSNPHLERF
FT                   GCFELSDADYTSCLAKAVQQPARLQIGSSAVSSGAWMPR"
     MNDLLAAYAA GWFPMAEGPD RALGLFRARN RALIPLDQRF HVPRSLRRQL RPGRFELKLN        60
     SAFAAVVDGC ADRPSTWISL ELRAIYQELH RLGWAHSIEA WDAHGLAGGQ LGLAIGRCWI       120
     GESMFHSRPH ASNVVLVQLQ SALRQGGFEL FDVQLSNPHL ERFGCFELSD ADYTSCLAKA       180
     VQQPARLQIG SSAVSSGAWM PR                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page