(data stored in ACNUC29543 zone)

EMBL: CT978603.ACPP

CT978603.ACPP        Location/Qualifiers
FT   CDS             complement(128401..128640)
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SynRCC307_0132"
FT                   /product="Acyl carrier protein"
FT                   /note="Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27035"
FT                   /db_xref="GOA:A5GQ76"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ76"
FT                   /protein_id="CAK27035.1"
FT                   /translation="MSQEILEKVRSIVAEQLSVDAAEVKPESNFQNDLGADSLDTVELV
FT                   MALEEAFDIEIPDEAAEGIATVGDAVSYIQEKKG"
     MSQEILEKVR SIVAEQLSVD AAEVKPESNF QNDLGADSLD TVELVMALEE AFDIEIPDEA        60
     AEGIATVGDA VSYIQEKKG                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page