(data stored in ACNUC29543 zone)

EMBL: CT978603.AHCY

CT978603.AHCY        Location/Qualifiers
FT   CDS             103547..104983
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="SynRCC307_0106"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27009"
FT                   /db_xref="GOA:A5GQ50"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ50"
FT                   /protein_id="CAK27009.1"
FT                   /translation="MVAAPEALSFAGLQATDTYVIADIAQAAFGRKEIAIAETEMPGLV
FT                   ELRNKYGAQQPLKGARICGSLHMTIQTAVLIETLVALGADVRWASCNIFSTQDHAAAAI
FT                   AERGIPVFAYKGETLDEYWAFTHRIMEWSDGGTPNMILDDGGDATGLIMLGSKAEQDIS
FT                   VLDNPSNEEEIALFKSIKARLAVDPTFYSRIKANILGVTEETTTGVARLYQMVETGELP
FT                   FPAINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVMGYGDVGKGSAQSLR
FT                   GLGATVCIAEVDPICALQAAMEGFRVVRLDDVVDQMDIFVTATGNFQVIRHEHLVRMKD
FT                   EAIVCNIGHFDNEIDVASLKQYEWDNIKPQVDHITLPSGNKIILLAEGRLVNLGCATGH
FT                   PSFVMSNSFTNQTLAQIELFTKRDQYENKVYVLPKHLDEMVARLHLDKIGAKLTELTSE
FT                   QAAYINVPVEGPYKVDHYRY"
     MVAAPEALSF AGLQATDTYV IADIAQAAFG RKEIAIAETE MPGLVELRNK YGAQQPLKGA        60
     RICGSLHMTI QTAVLIETLV ALGADVRWAS CNIFSTQDHA AAAIAERGIP VFAYKGETLD       120
     EYWAFTHRIM EWSDGGTPNM ILDDGGDATG LIMLGSKAEQ DISVLDNPSN EEEIALFKSI       180
     KARLAVDPTF YSRIKANILG VTEETTTGVA RLYQMVETGE LPFPAINVND SVTKSKFDNL       240
     YGCRESLVDS IKRATDVMVA GKQALVMGYG DVGKGSAQSL RGLGATVCIA EVDPICALQA       300
     AMEGFRVVRL DDVVDQMDIF VTATGNFQVI RHEHLVRMKD EAIVCNIGHF DNEIDVASLK       360
     QYEWDNIKPQ VDHITLPSGN KIILLAEGRL VNLGCATGHP SFVMSNSFTN QTLAQIELFT       420
     KRDQYENKVY VLPKHLDEMV ARLHLDKIGA KLTELTSEQA AYINVPVEGP YKVDHYRY         478
//

If you have problems or comments...

PBIL Back to PBIL home page