(data stored in ACNUC29543 zone)

EMBL: CT978603.AROH

CT978603.AROH        Location/Qualifiers
FT   CDS             complement(581204..581602)
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="SynRCC307_0643"
FT                   /product="Chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27546"
FT                   /db_xref="GOA:A5GRN7"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN7"
FT                   /protein_id="CAK27546.1"
FT                   /translation="MAIPAMSNTSLKMRALRGATTASANTAAAMTEAVDELLDALISNN
FT                   GLQGDQVLSATFSVTADLDAMFPASLARRRPGWDGVALLDCQQMRVQGDLPRCIRVLVQ
FT                   AQMPAEQTLHHPYLRDTQRLRPDRSSHN"
     MAIPAMSNTS LKMRALRGAT TASANTAAAM TEAVDELLDA LISNNGLQGD QVLSATFSVT        60
     ADLDAMFPAS LARRRPGWDG VALLDCQQMR VQGDLPRCIR VLVQAQMPAE QTLHHPYLRD       120
     TQRLRPDRSS HN                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page