(data stored in ACNUC29543 zone)

EMBL: CT978603.AROK

CT978603.AROK        Location/Qualifiers
FT   CDS             complement(288534..289121)
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SynRCC307_0291"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27194"
FT                   /db_xref="GOA:A5GQN5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQN5"
FT                   /protein_id="CAK27194.1"
FT                   /translation="MHPTDPSQPLGERLQGTNLYLVGMMGSGKSTVGPLLAKALGYRFL
FT                   DADAVISQAAGCSIPEIFERDGEEGFRQLERQVLQQLSQWHSLVVATGGGIVTVPANWG
FT                   ELRQGVVIWLDVAEEELMRRLQADPGGRPLLAGDDPAGRLHGLLEKRQPLYGQADLRVS
FT                   AQGEGASDISERILQQLPGLLKAPGAPQTTAP"
     MHPTDPSQPL GERLQGTNLY LVGMMGSGKS TVGPLLAKAL GYRFLDADAV ISQAAGCSIP        60
     EIFERDGEEG FRQLERQVLQ QLSQWHSLVV ATGGGIVTVP ANWGELRQGV VIWLDVAEEE       120
     LMRRLQADPG GRPLLAGDDP AGRLHGLLEK RQPLYGQADL RVSAQGEGAS DISERILQQL       180
     PGLLKAPGAP QTTAP                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page