(data stored in ACNUC29543 zone)

EMBL: CT978603.AROQ

CT978603.AROQ        Location/Qualifiers
FT   CDS             429420..429863
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="SynRCC307_0456"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27359"
FT                   /db_xref="GOA:A5GR50"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR50"
FT                   /protein_id="CAK27359.1"
FT                   /translation="MRILVLHGPNLNLLGSREPGLYGRDTLSEIDAELQQQAERLGAEL
FT                   VCFQSNHEGALVDQIQQAASEMDGILINAGAFTHTSVAIRDALLAVKLPFVELHLSNVH
FT                   AREEFRHSSYLADKAVGVICGFGPISYYLALEGMVAHLRSSQL"
     MRILVLHGPN LNLLGSREPG LYGRDTLSEI DAELQQQAER LGAELVCFQS NHEGALVDQI        60
     QQAASEMDGI LINAGAFTHT SVAIRDALLA VKLPFVELHL SNVHAREEFR HSSYLADKAV       120
     GVICGFGPIS YYLALEGMVA HLRSSQL                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page