(data stored in ACNUC29543 zone)

EMBL: CT978603.CBID

CT978603.CBID        Location/Qualifiers
FT   CDS             43913..45175
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="SynRCC307_0048"
FT                   /product="Cobalamin biosynthesis protein CbiD"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26951"
FT                   /db_xref="GOA:A5GPZ2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ2"
FT                   /protein_id="CAK26951.1"
FT                   /translation="MPSPGAPVPAPEWGQGSSVEACPSCRWVGGRNPAGGSFTLKSSRL
FT                   SPLSASSALDSGYTLPVWVAVAAVAALRQLRGDPSAERIGLELLQPAGQRELPIEAVAP
FT                   FADGSALAISRCDPGPGMDLTRGLAVWVRARWAEPLEGACFQLQAGVGVGRLVEGGEVC
FT                   LSGFARDLLQHNLAALVPADRSVALEVVLPQGRERALRTSNAAFGVVEGLALIGTQAEV
FT                   QRSAAPDQLQGALDELRQRAERPQGCPELVLVVGENGLDLAPRLGLPVEVLLKSGNWIG
FT                   PLLAAAAEQGVQRLLLFGYHGKLLKLAGGIFHTHHHLADGRAEVLTALAALEGVQGELL
FT                   RELHSSATTEAALQLLRQREPELEQRLRQRITAAIEKRAAASIQATTGLTLEPGVALFD
FT                   RSRQLWAVGPRGQSWFAEAAF"
     MPSPGAPVPA PEWGQGSSVE ACPSCRWVGG RNPAGGSFTL KSSRLSPLSA SSALDSGYTL        60
     PVWVAVAAVA ALRQLRGDPS AERIGLELLQ PAGQRELPIE AVAPFADGSA LAISRCDPGP       120
     GMDLTRGLAV WVRARWAEPL EGACFQLQAG VGVGRLVEGG EVCLSGFARD LLQHNLAALV       180
     PADRSVALEV VLPQGRERAL RTSNAAFGVV EGLALIGTQA EVQRSAAPDQ LQGALDELRQ       240
     RAERPQGCPE LVLVVGENGL DLAPRLGLPV EVLLKSGNWI GPLLAAAAEQ GVQRLLLFGY       300
     HGKLLKLAGG IFHTHHHLAD GRAEVLTALA ALEGVQGELL RELHSSATTE AALQLLRQRE       360
     PELEQRLRQR ITAAIEKRAA ASIQATTGLT LEPGVALFDR SRQLWAVGPR GQSWFAEAAF       420
//

If you have problems or comments...

PBIL Back to PBIL home page