(data stored in ACNUC29543 zone)

EMBL: CT978603.COBD/CBIB

CT978603.COBD/CBIB   Location/Qualifiers
FT   CDS             complement(527472..528407)
FT                   /transl_table=11
FT                   /gene="cobD/cbiB"
FT                   /locus_tag="SynRCC307_0593"
FT                   /product="Cobalamin biosynthesis protein CobD/CbiB"
FT                   /EC_number="6.3.1.10"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27496"
FT                   /db_xref="GOA:A5GRI7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI7"
FT                   /protein_id="CAK27496.1"
FT                   /translation="MAAACGLDRLIGDPRWCLHPVQVMGAVIAQLRLWVEALGGDRPWA
FT                   LRLGGGLITALLVSGSAAAGWALEQLSLRSPWAMPLLVIALASALAGRSLRLAVEDVIK
FT                   PLSSAPPQLQQARQKLAWIVGRDVDGLPAPELLRALAETASENAVDGLFAPLFWMLIGA
FT                   GLWGLNPALPGPLALAWAFKASSTLDSMLGYRRGRLQWLGTAGARLDDGLTWLPCRLLA
FT                   LSLGQLGPALRDGASDPSPNAGVSQAAYAHALGLRLGGLNRYGGIERAKPLLNEGGRAA
FT                   DEKGVQAILDVSQRSALLWLGLSGVVALLA"
     MAAACGLDRL IGDPRWCLHP VQVMGAVIAQ LRLWVEALGG DRPWALRLGG GLITALLVSG        60
     SAAAGWALEQ LSLRSPWAMP LLVIALASAL AGRSLRLAVE DVIKPLSSAP PQLQQARQKL       120
     AWIVGRDVDG LPAPELLRAL AETASENAVD GLFAPLFWML IGAGLWGLNP ALPGPLALAW       180
     AFKASSTLDS MLGYRRGRLQ WLGTAGARLD DGLTWLPCRL LALSLGQLGP ALRDGASDPS       240
     PNAGVSQAAY AHALGLRLGG LNRYGGIERA KPLLNEGGRA ADEKGVQAIL DVSQRSALLW       300
     LGLSGVVALL A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page