(data stored in ACNUC29543 zone)

EMBL: CT978603.CTAD,-COXA

CT978603.CTAD,-COXA  Location/Qualifiers
FT   CDS             complement(608063..609733)
FT                   /transl_table=11
FT                   /gene="ctaD, coxA"
FT                   /locus_tag="SynRCC307_0671"
FT                   /product="Cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27574"
FT                   /db_xref="GOA:A5GRR5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR5"
FT                   /protein_id="CAK27574.1"
FT                   /translation="MTIASPPSPSPQPLRLQPTGWLRYFSFSLDHKVIGLQYIVCGFLF
FT                   YFVGGALAGVIRTELATPISDFVSRDTYNQVLTLHGTVMIFLWIVPVVNGGFGNYLIPF
FT                   YVGARDMAFPRLNAVAFWMIPPSGLLLISSYFIGGAAQSGWTAYPPLSLTTPAMGQILW
FT                   IVSVLLLGGSSIFGGINFIATILKFRQPGLKLMMLPMYCWAMLGTSILVVLATPVLAGT
FT                   LILLSLDIVAHTGFFNPAAGGNAVVYQHLFWFYSHPAVYIMVLPAFGLVSEILPVHARK
FT                   PLFGYVTMVYSIMAIVILGLVVWAHHMFTSGTPPWMRLFFTIATAFIAVPTGIKFFNWI
FT                   ATLWQGRLALNSAMLFSCAFILQFVFGGITGVALAQVPFDVHVHDTYFVVAHFHYIVYG
FT                   GTVFVIFASIYHWFPKFSGRMLNEHLGRLHLALTFIGFNLCFAPQHWLGLNGMPRRVAE
FT                   YDPQFTLINQLSSVGALLMAISTLPFLINVVMSLLQGPAAGPNPWRALTPEWLTSSPPP
FT                   VENWIGAAPLVKEPYGYGSTEGRIDVNQARGQDLWRQQP"
     MTIASPPSPS PQPLRLQPTG WLRYFSFSLD HKVIGLQYIV CGFLFYFVGG ALAGVIRTEL        60
     ATPISDFVSR DTYNQVLTLH GTVMIFLWIV PVVNGGFGNY LIPFYVGARD MAFPRLNAVA       120
     FWMIPPSGLL LISSYFIGGA AQSGWTAYPP LSLTTPAMGQ ILWIVSVLLL GGSSIFGGIN       180
     FIATILKFRQ PGLKLMMLPM YCWAMLGTSI LVVLATPVLA GTLILLSLDI VAHTGFFNPA       240
     AGGNAVVYQH LFWFYSHPAV YIMVLPAFGL VSEILPVHAR KPLFGYVTMV YSIMAIVILG       300
     LVVWAHHMFT SGTPPWMRLF FTIATAFIAV PTGIKFFNWI ATLWQGRLAL NSAMLFSCAF       360
     ILQFVFGGIT GVALAQVPFD VHVHDTYFVV AHFHYIVYGG TVFVIFASIY HWFPKFSGRM       420
     LNEHLGRLHL ALTFIGFNLC FAPQHWLGLN GMPRRVAEYD PQFTLINQLS SVGALLMAIS       480
     TLPFLINVVM SLLQGPAAGP NPWRALTPEW LTSSPPPVEN WIGAAPLVKE PYGYGSTEGR       540
     IDVNQARGQD LWRQQP                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page