(data stored in ACNUC29543 zone)

EMBL: CT978603.CTAE,-COXC

CT978603.CTAE,-COXC  Location/Qualifiers
FT   CDS             complement(607443..608066)
FT                   /transl_table=11
FT                   /gene="ctaE, coxC"
FT                   /locus_tag="SynRCC307_0670"
FT                   /product="Cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27573"
FT                   /db_xref="GOA:A5GRR4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR4"
FT                   /protein_id="CAK27573.1"
FT                   /translation="MTTTTPIDTDLQQQDDNENHGHGHGHGEHPDLRMFGLATFLVADG
FT                   MTFAGFFAAYLTYRAVNPLPPGAIYELELVLPVINTAILIASSFTFHRASKELMRGAMG
FT                   ACRGWLLLTAVMGLSFLGGQMVEYFELPFGLTDNLYASTFYALTGFHGLHVTLGALMIL
FT                   IVWFQAREPGRFTPSDHFGLAAAELYWHFVDVIWVVLFGLLYLL"
     MTTTTPIDTD LQQQDDNENH GHGHGHGEHP DLRMFGLATF LVADGMTFAG FFAAYLTYRA        60
     VNPLPPGAIY ELELVLPVIN TAILIASSFT FHRASKELMR GAMGACRGWL LLTAVMGLSF       120
     LGGQMVEYFE LPFGLTDNLY ASTFYALTGF HGLHVTLGAL MILIVWFQAR EPGRFTPSDH       180
     FGLAAAELYW HFVDVIWVVL FGLLYLL                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page