(data stored in ACNUC29543 zone)

EMBL: CT978603.CYSE

CT978603.CYSE        Location/Qualifiers
FT   CDS             complement(86489..87190)
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SynRCC307_0087"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26990"
FT                   /db_xref="GOA:A5GQ31"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ31"
FT                   /protein_id="CAK26990.1"
FT                   /translation="MLHSLRADIAIIRDRDPAARGVLEILLCYPGLHALCLHRLSHRLW
FT                   TAGLPLIPRLMSQLGRLITGVEIHPGASIGQGVFIDHGMGVVIGETAVVGNRCLLYQGV
FT                   TLGGTGKQSGQRHPVLGENVVVGAGAKVLGGISVGANTRIGAGSVLLRDVDADCTVVGV
FT                   PGRVIHQSGVRINPLAHSQLPDAEAQVIRNLMERIDALENALARGGQAPAAQAQSLRDR
FT                   EILEFLEGSGI"
     MLHSLRADIA IIRDRDPAAR GVLEILLCYP GLHALCLHRL SHRLWTAGLP LIPRLMSQLG        60
     RLITGVEIHP GASIGQGVFI DHGMGVVIGE TAVVGNRCLL YQGVTLGGTG KQSGQRHPVL       120
     GENVVVGAGA KVLGGISVGA NTRIGAGSVL LRDVDADCTV VGVPGRVIHQ SGVRINPLAH       180
     SQLPDAEAQV IRNLMERIDA LENALARGGQ APAAQAQSLR DREILEFLEG SGI              233
//

If you have problems or comments...

PBIL Back to PBIL home page