(data stored in ACNUC29543 zone)

EMBL: CT978603.DAPA

CT978603.DAPA        Location/Qualifiers
FT   CDS             65074..65973
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="SynRCC307_0069"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /note="Amino acid transport and metabolism / Cell envelope
FT                   biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26972"
FT                   /db_xref="GOA:A5GQ13"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ13"
FT                   /protein_id="CAK26972.1"
FT                   /translation="MSSLSSAPFGRVVTAMVTPFAADGSLDLPLAARLAQHLVAHGSDG
FT                   LLVCGTTGESPTLSWDEQLALIKTVLDAVGEKVPVLAGTGSNSTAEAVEATREAAALGA
FT                   HGALVVVPYYNRPPQEGLEAHFRAVAAAAPELPLMLYNIPGRTGCSLHPATTARLLDCD
FT                   NVVAYKAASGTTSEVSALRLACGSRLAIYSGDDGLTLPMLAAGAVGVVSVTSHLAGVEL
FT                   SAMIDHYMAGRHAEALALHERLLPLMEGLFCTSNPTPVKAALELQGWPVGAPRLPLMPA
FT                   DSSVRDTLSTLMAALRPT"
     MSSLSSAPFG RVVTAMVTPF AADGSLDLPL AARLAQHLVA HGSDGLLVCG TTGESPTLSW        60
     DEQLALIKTV LDAVGEKVPV LAGTGSNSTA EAVEATREAA ALGAHGALVV VPYYNRPPQE       120
     GLEAHFRAVA AAAPELPLML YNIPGRTGCS LHPATTARLL DCDNVVAYKA ASGTTSEVSA       180
     LRLACGSRLA IYSGDDGLTL PMLAAGAVGV VSVTSHLAGV ELSAMIDHYM AGRHAEALAL       240
     HERLLPLMEG LFCTSNPTPV KAALELQGWP VGAPRLPLMP ADSSVRDTLS TLMAALRPT        299
//

If you have problems or comments...

PBIL Back to PBIL home page