(data stored in ACNUC29543 zone)

EMBL: CT978603.DEF

CT978603.DEF         Location/Qualifiers
FT   CDS             complement(340850..341455)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="SynRCC307_0355"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27258"
FT                   /db_xref="GOA:A5GQU9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQU9"
FT                   /protein_id="CAK27258.1"
FT                   /translation="MSLNFAAMARQSERQASTVMVPKGEEQPESPKIHTLGSNELRKPA
FT                   KRISKVNEQVRELAREMLRSMYAAHGIGLAAPQVGVHQQLLVIDLDPEEAANPPLVLIN
FT                   PEIVATSGALDTYEEGCLSIPGVYLNVVRPSQVDVKYRDELGRPQRRKADGLMARCILH
FT                   EMDHLNGVLFVDRVSDELSLSGELQRLGFDRNDVKPVA"
     MSLNFAAMAR QSERQASTVM VPKGEEQPES PKIHTLGSNE LRKPAKRISK VNEQVRELAR        60
     EMLRSMYAAH GIGLAAPQVG VHQQLLVIDL DPEEAANPPL VLINPEIVAT SGALDTYEEG       120
     CLSIPGVYLN VVRPSQVDVK YRDELGRPQR RKADGLMARC ILHEMDHLNG VLFVDRVSDE       180
     LSLSGELQRL GFDRNDVKPV A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page