(data stored in ACNUC29543 zone)

EMBL: CT978603.DPPC

CT978603.DPPC        Location/Qualifiers
FT   CDS             504385..505257
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="SynRCC307_0569"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27472"
FT                   /db_xref="GOA:A5GRG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG3"
FT                   /protein_id="CAK27472.1"
FT                   /translation="MASLWLQRFWTWRPRSLSARLARVGLWVLLFYVLIALISPVLFGI
FT                   GLLPDVNTGLENEINAPPSLEHWCGTNRLGQDVCARTIAGAGVALKVVVLALTLALIVG
FT                   VPLGMLSGYFGGPVDRALVLLMDTVYSLPVVLLAVVMAFLLGQGLLNAAAALCVVYVPQ
FT                   YFRVVRNQTASVKAELFVEAAQSLGAGPVWIMRKYLFRNVITSVPVVLTMNAADSVLML
FT                   GSLGFLGLGLPAVVPEWGAELKQALTALPTGIWWTALYPGVAMFILVLALSFIGEGLDA
FT                   WVSGDEARP"
     MASLWLQRFW TWRPRSLSAR LARVGLWVLL FYVLIALISP VLFGIGLLPD VNTGLENEIN        60
     APPSLEHWCG TNRLGQDVCA RTIAGAGVAL KVVVLALTLA LIVGVPLGML SGYFGGPVDR       120
     ALVLLMDTVY SLPVVLLAVV MAFLLGQGLL NAAAALCVVY VPQYFRVVRN QTASVKAELF       180
     VEAAQSLGAG PVWIMRKYLF RNVITSVPVV LTMNAADSVL MLGSLGFLGL GLPAVVPEWG       240
     AELKQALTAL PTGIWWTALY PGVAMFILVL ALSFIGEGLD AWVSGDEARP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page