(data stored in ACNUC29543 zone)

EMBL: CT978603.FABD

CT978603.FABD        Location/Qualifiers
FT   CDS             complement(244917..245810)
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SynRCC307_0247"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27150"
FT                   /db_xref="GOA:A5GQJ1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ1"
FT                   /protein_id="CAK27150.1"
FT                   /translation="MGNAWVFPGQGSQKQGMAAGLADHPLGKERFDLASELLGRDLAAI
FT                   CAGEATGELSDLNDTRNTQPALFVVESCLVDLLHEQGRQAELLAGHSLGELVALYAGGV
FT                   FDARTGIELVIRRSQLMAAAGGGAMTAVMGFERSALDDAVANTPDVVIANDNSDAQVVL
FT                   SGSKEGVDAVVAAVTCKRAVPLAVSGAFHSPFMAEPAAAFAEQLDGLSFADSRVPVLSN
FT                   THPTPCTEGGQLKQRLRAQMTTGVRWRETMQTLAAEGISTTVEVGPGAVLSGLIKRSLK
FT                   GVTPAQINGIESLGQA"
     MGNAWVFPGQ GSQKQGMAAG LADHPLGKER FDLASELLGR DLAAICAGEA TGELSDLNDT        60
     RNTQPALFVV ESCLVDLLHE QGRQAELLAG HSLGELVALY AGGVFDARTG IELVIRRSQL       120
     MAAAGGGAMT AVMGFERSAL DDAVANTPDV VIANDNSDAQ VVLSGSKEGV DAVVAAVTCK       180
     RAVPLAVSGA FHSPFMAEPA AAFAEQLDGL SFADSRVPVL SNTHPTPCTE GGQLKQRLRA       240
     QMTTGVRWRE TMQTLAAEGI STTVEVGPGA VLSGLIKRSL KGVTPAQING IESLGQA          297
//

If you have problems or comments...

PBIL Back to PBIL home page