(data stored in ACNUC29543 zone)

EMBL: CT978603.FOLC

CT978603.FOLC        Location/Qualifiers
FT   CDS             complement(543423..544625)
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SynRCC307_0610"
FT                   /product="FolC bifunctional protein (Folylpolyglutamate
FT                   synthase / Dihydrofolate synthase)"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27513"
FT                   /db_xref="GOA:A5GRK4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK4"
FT                   /protein_id="CAK27513.1"
FT                   /translation="MQLPDPVELGDLLEPFSRRGIDLGLDRLHQALAAGGHPEQRFPAV
FT                   QVAGTNGKGSICTALGAILQAAGLKAGLYRSPHLISWCERIAIGNQWIAAEQLRSLLQR
FT                   WQSLGQQHQLTPFELLTAAAMDHFAAAQVDLAVLEVGLGGRLDATTCHPNRPVLGIANI
FT                   GLDHREHLGSTLEAIATEKAGIFHTGAVAFSAPQPDSVAEVLEQQAQQRGCQLHWVEPL
FT                   AAEVPLGLAGSWQRSNAAVALAMAQELARQGWPISVQAMAQGLAQAQWSGRLQRRQWRG
FT                   QPVLIDGAHNPPAAEGLRRELNQLAPGQPRHWLLGIQRHKDGPAIVRALMAPGDRAWMV
FT                   PIEGCRSWQAAELTIPGVHDSPSAEQALEQLWPAACEPVIAGSLYLLGQLWPTLEPPAE
FT                   G"
     MQLPDPVELG DLLEPFSRRG IDLGLDRLHQ ALAAGGHPEQ RFPAVQVAGT NGKGSICTAL        60
     GAILQAAGLK AGLYRSPHLI SWCERIAIGN QWIAAEQLRS LLQRWQSLGQ QHQLTPFELL       120
     TAAAMDHFAA AQVDLAVLEV GLGGRLDATT CHPNRPVLGI ANIGLDHREH LGSTLEAIAT       180
     EKAGIFHTGA VAFSAPQPDS VAEVLEQQAQ QRGCQLHWVE PLAAEVPLGL AGSWQRSNAA       240
     VALAMAQELA RQGWPISVQA MAQGLAQAQW SGRLQRRQWR GQPVLIDGAH NPPAAEGLRR       300
     ELNQLAPGQP RHWLLGIQRH KDGPAIVRAL MAPGDRAWMV PIEGCRSWQA AELTIPGVHD       360
     SPSAEQALEQ LWPAACEPVI AGSLYLLGQL WPTLEPPAEG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page