(data stored in ACNUC29543 zone)

EMBL: CT978603.GLCF

CT978603.GLCF        Location/Qualifiers
FT   CDS             complement(143355..144719)
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="SynRCC307_0148"
FT                   /product="Glycolate oxidase iron-sulfur subunit"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27051"
FT                   /db_xref="GOA:A5GQ92"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ92"
FT                   /protein_id="CAK27051.1"
FT                   /translation="MVVGRKAEDAHQKPAGARSLPWGAIKSQTAAMTNPLPASDPCVHC
FT                   GFCLPTCASYRVLGTEMDSPRGRIHTLKAIAAGELELDAAVPPHFDSCLGCFACVSACP
FT                   AGVRYDQLIEQVRPQLNKAELRSPWQRQLRRLLLGVIPYPQRLRALLQPFRLYAGGPIQ
FT                   RFARMSGLVKLFGPEVAAMEQLLPALPEDAFGPDPQGVLPAQGKQRARVGLVLGCVQRV
FT                   FDPAVNQATIAVLRANGVEVVLPASQGCCGAASHHQGELEQTRDLARDLVKQFEGEPLD
FT                   AVLVAASGCGHTLKQYGELLPGEEGFSAPVLDVHEFLSQLGLSETFQAQLQPLPKAVAY
FT                   HDACHMIHGQGIAAQPRQLLRAIPELQLREATEAGVCCGSAGIYNLVQPEEAAALGQLK
FT                   AADLSGTGAELIASANIGCSLQIRQHVGPDGPPVLHPMQLLAISAGLLPATASNG"
     MVVGRKAEDA HQKPAGARSL PWGAIKSQTA AMTNPLPASD PCVHCGFCLP TCASYRVLGT        60
     EMDSPRGRIH TLKAIAAGEL ELDAAVPPHF DSCLGCFACV SACPAGVRYD QLIEQVRPQL       120
     NKAELRSPWQ RQLRRLLLGV IPYPQRLRAL LQPFRLYAGG PIQRFARMSG LVKLFGPEVA       180
     AMEQLLPALP EDAFGPDPQG VLPAQGKQRA RVGLVLGCVQ RVFDPAVNQA TIAVLRANGV       240
     EVVLPASQGC CGAASHHQGE LEQTRDLARD LVKQFEGEPL DAVLVAASGC GHTLKQYGEL       300
     LPGEEGFSAP VLDVHEFLSQ LGLSETFQAQ LQPLPKAVAY HDACHMIHGQ GIAAQPRQLL       360
     RAIPELQLRE ATEAGVCCGS AGIYNLVQPE EAAALGQLKA ADLSGTGAEL IASANIGCSL       420
     QIRQHVGPDG PPVLHPMQLL AISAGLLPAT ASNG                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page