(data stored in ACNUC29543 zone)

EMBL: CT978603.ILVC

CT978603.ILVC        Location/Qualifiers
FT   CDS             complement(528422..529417)
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SynRCC307_0594"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="Amino acid transport and metabolism / Coenzyme
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27497"
FT                   /db_xref="GOA:A5GRI8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRI8"
FT                   /protein_id="CAK27497.1"
FT                   /translation="MATLYYDTDADLGLLSGKTVAIIGYGSQGHAHALNLKDSGVDVVV
FT                   GLYEGSRSADKAKADGLEVLSVADAAAKADWIMVLLPDEFQKEVYDKEIAPHLSAGKVL
FT                   SFAHGFNIRFGLIKPPADVDVVMIAPKGPGHTVRWEYQNAQGVPALFAIEQDASGNARG
FT                   LAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLSELVKAGFETLVEAGYQPE
FT                   LAYFECLHEVKLIVDLMVKGGLSAMRDSISNTAEYGDYVSGPRLITAETKAEMKRILGD
FT                   IQDGTFAKNFVAECEAGKPEMNKIRERDSAHKIEEVGKGLRAMFSWLKAA"
     MATLYYDTDA DLGLLSGKTV AIIGYGSQGH AHALNLKDSG VDVVVGLYEG SRSADKAKAD        60
     GLEVLSVADA AAKADWIMVL LPDEFQKEVY DKEIAPHLSA GKVLSFAHGF NIRFGLIKPP       120
     ADVDVVMIAP KGPGHTVRWE YQNAQGVPAL FAIEQDASGN ARGLAMAYAK GIGGTRAGIL       180
     ETNFKEETET DLFGEQAVLC GGLSELVKAG FETLVEAGYQ PELAYFECLH EVKLIVDLMV       240
     KGGLSAMRDS ISNTAEYGDY VSGPRLITAE TKAEMKRILG DIQDGTFAKN FVAECEAGKP       300
     EMNKIRERDS AHKIEEVGKG LRAMFSWLKA A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page