(data stored in ACNUC29543 zone)

EMBL: CT978603.LYSC

CT978603.LYSC        Location/Qualifiers
FT   CDS             complement(72639..74441)
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="SynRCC307_0075"
FT                   /product="Aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26978"
FT                   /db_xref="GOA:A5GQ19"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ19"
FT                   /protein_id="CAK26978.1"
FT                   /translation="MALLVQKYGGTSVGSVERIQAVAKRVAAARLDGHDLVVVVSAMGH
FT                   TTDELTALARALNPDPPQREMDMLLATGEQVSIALLSMALQAEGVAATSMTGPQVGIVT
FT                   ESAHGRARILEVRTERVKRRLHDGHVVVVAGFQGTSTGSAGTPEITTLGRGGSDTSAVA
FT                   LAAALGADACEIYTDVPGVLTTDPRKVPEAQLMTQVSCDEMLELASLGAAVLHPRAVEI
FT                   ARNYGVPLIVRSSWSDEPGTRLFSQPSRRIGSEGLELGKPVDRAELLEGQAVVALAHVP
FT                   DEPGVAARLFEGLGAAGLNVDLIVQATHDGSSNDIAFTLAEAELPAAEAFCREHLGEGS
FT                   QLQVQSGLAKLSIGGAGIMGRPGVAAQLFDGLSKMGISLRMIATSEVKVSCLIQGEQAA
FT                   KALRTAAQVFELDDHQLQHNPLPGGEGEPDVRGVALDRDQAQLTVTAVPDRPGSAAALC
FT                   RALADGGISLDTIVQSERQRQTDLGLCRDIAFTLPRDDLSRASEALRPLLKLWPGAELV
FT                   EGKAIARVSAVGAGMPSTPGSAAKMFRALADAGINIEMIATSEIRISCVVPEDDGIGAL
FT                   QAVHQAFGLNGESQHQAQGSEWAG"
     MALLVQKYGG TSVGSVERIQ AVAKRVAAAR LDGHDLVVVV SAMGHTTDEL TALARALNPD        60
     PPQREMDMLL ATGEQVSIAL LSMALQAEGV AATSMTGPQV GIVTESAHGR ARILEVRTER       120
     VKRRLHDGHV VVVAGFQGTS TGSAGTPEIT TLGRGGSDTS AVALAAALGA DACEIYTDVP       180
     GVLTTDPRKV PEAQLMTQVS CDEMLELASL GAAVLHPRAV EIARNYGVPL IVRSSWSDEP       240
     GTRLFSQPSR RIGSEGLELG KPVDRAELLE GQAVVALAHV PDEPGVAARL FEGLGAAGLN       300
     VDLIVQATHD GSSNDIAFTL AEAELPAAEA FCREHLGEGS QLQVQSGLAK LSIGGAGIMG       360
     RPGVAAQLFD GLSKMGISLR MIATSEVKVS CLIQGEQAAK ALRTAAQVFE LDDHQLQHNP       420
     LPGGEGEPDV RGVALDRDQA QLTVTAVPDR PGSAAALCRA LADGGISLDT IVQSERQRQT       480
     DLGLCRDIAF TLPRDDLSRA SEALRPLLKL WPGAELVEGK AIARVSAVGA GMPSTPGSAA       540
     KMFRALADAG INIEMIATSE IRISCVVPED DGIGALQAVH QAFGLNGESQ HQAQGSEWAG       600
//

If you have problems or comments...

PBIL Back to PBIL home page