(data stored in ACNUC29543 zone)

EMBL: CT978603.METF

CT978603.METF        Location/Qualifiers
FT   CDS             227055..227966
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SynRCC307_0227"
FT                   /product="5-10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27130"
FT                   /db_xref="GOA:A5GQH1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH1"
FT                   /protein_id="CAK27130.1"
FT                   /translation="MSNLLASSLEKALASGQPVITAEITPPVGADPSHALEMAEGLRGQ
FT                   VQAFNVTDGSRAVMGMSSLALCRLLLERGLEPILQLGCRDRNRIALQADLLGAHALGIR
FT                   NVLCLTGDPVKAGNQPEARAVFDLESVRLLRQVQQLNGGVGPAGKPLADGAPALFPGAA
FT                   ADPQSASWSGLKSRMRRKAEAGARFVQTQMVMDASALRRFCTEIAAPLNVPVLAGVFLL
FT                   KSAKNAAFINRVVPGAQIPLPLIDRLAAAENPRLEGIRIAAEQVQSYSAIAAGVHLMAV
FT                   KAEESLPQVLELAGLPKVVAQV"
     MSNLLASSLE KALASGQPVI TAEITPPVGA DPSHALEMAE GLRGQVQAFN VTDGSRAVMG        60
     MSSLALCRLL LERGLEPILQ LGCRDRNRIA LQADLLGAHA LGIRNVLCLT GDPVKAGNQP       120
     EARAVFDLES VRLLRQVQQL NGGVGPAGKP LADGAPALFP GAAADPQSAS WSGLKSRMRR       180
     KAEAGARFVQ TQMVMDASAL RRFCTEIAAP LNVPVLAGVF LLKSAKNAAF INRVVPGAQI       240
     PLPLIDRLAA AENPRLEGIR IAAEQVQSYS AIAAGVHLMA VKAEESLPQV LELAGLPKVV       300
     AQV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page