(data stored in ACNUC29543 zone)

EMBL: CT978603.MIND

CT978603.MIND        Location/Qualifiers
FT   CDS             complement(412259..413077)
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="SynRCC307_0437"
FT                   /product="Septum site-determining protein MinD"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27340"
FT                   /db_xref="GOA:A5GR31"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR31"
FT                   /protein_id="CAK27340.1"
FT                   /translation="MTGSSTRTILICSGKGGVGKTTLTANLGIALASQGVRTAVLDADF
FT                   GLRNLDLLLGLENRIVYTAQEVLAGNCRLEQAMVKHKLQPNLALLPAGNPRMLEWLKPE
FT                   DMQKIVGLIQPHFDVVLIDAPAGIEDGFKNAAAAADEAIVVTTPEVSAVRDADRVIGLL
FT                   NTRGVEPIQLVLNRVRPKMMQSQEMLGVTDVTDILALPLLGLVFEDEQVIVSTNRGEPL
FT                   TLNGSSSPAAIAYRNVAKRLQGEEVPLPDPTKQRRGLRAKMRQLMQTKLF"
     MTGSSTRTIL ICSGKGGVGK TTLTANLGIA LASQGVRTAV LDADFGLRNL DLLLGLENRI        60
     VYTAQEVLAG NCRLEQAMVK HKLQPNLALL PAGNPRMLEW LKPEDMQKIV GLIQPHFDVV       120
     LIDAPAGIED GFKNAAAAAD EAIVVTTPEV SAVRDADRVI GLLNTRGVEP IQLVLNRVRP       180
     KMMQSQEMLG VTDVTDILAL PLLGLVFEDE QVIVSTNRGE PLTLNGSSSP AAIAYRNVAK       240
     RLQGEEVPLP DPTKQRRGLR AKMRQLMQTK LF                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page