(data stored in ACNUC29543 zone)

EMBL: CT978603.MSRB

CT978603.MSRB        Location/Qualifiers
FT   CDS             18406..18960
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="SynRCC307_0016"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.6"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26919"
FT                   /db_xref="GOA:A5GPW0"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW0"
FT                   /protein_id="CAK26919.1"
FT                   /translation="MRLGAGAGAAHSPMLQSDLPRPMAQWPRRSLLQAAAAVFGSLFRP
FT                   KAALAASAADPAWQLSDQQWRERLSPEAFRVLRQEGTEPPFSSPLNNEKRPGTFVCAGC
FT                   QQPLFASSTKFDSGTGWPSFWQPLPDAIDTQVDFRLIIPRTEYHCRRCGGHQGHVFNDG
FT                   PRPTGQRYCNNGVALAFVPDA"
     MRLGAGAGAA HSPMLQSDLP RPMAQWPRRS LLQAAAAVFG SLFRPKAALA ASAADPAWQL        60
     SDQQWRERLS PEAFRVLRQE GTEPPFSSPL NNEKRPGTFV CAGCQQPLFA SSTKFDSGTG       120
     WPSFWQPLPD AIDTQVDFRL IIPRTEYHCR RCGGHQGHVF NDGPRPTGQR YCNNGVALAF       180
     VPDA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page