(data stored in ACNUC29543 zone)

EMBL: CT978603.MUTS

CT978603.MUTS        Location/Qualifiers
FT   CDS             complement(76041..78698)
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="SynRCC307_0078"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="Low identity with RCC0315"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26981"
FT                   /db_xref="GOA:A5GQ22"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ22"
FT                   /protein_id="CAK26981.1"
FT                   /translation="MAPGEQQLSLVPDDTIQGSLFAPEPSEDKTEESERPKQRRSHPGR
FT                   RTAPAAQHNEDSSNNDDEGLPRWHHHGLVDPLALTPMLRHYVELKAAHPERVLLYRLGD
FT                   FFECFFEDALLTSRLLELTLTGKEGGKSIGRVPMAGIPHHAAERYCSELVRRGHAVALC
FT                   DQLETTAAKGALLKRDITRVLTPGTVLEEGMLAARRNNWLAAVVLDDEQRWGLAVADVS
FT                   TGELLLHERQGTTELQQQLLQLEAAELLLPGIEAAEWCPDGLGLTQQPRTPFEAASADR
FT                   ALKQRFGVRNLEGLGLADHPLARRAAGGLIAYLDASQPGSTVPLERPQLVFAGDALVLD
FT                   HQTRRNLELTATQRDGQFQGSLLWAIDRSHTAMGGRALRRWLEAPLLDATAIRGRQEAI
FT                   TELVEQRPLRLSVRRLLRPMADLERLAGRCGAGRASARDLVALADGLERLPLLADLLKS
FT                   SSAAPLADLQQPRPDLQQLAELLRFQLVDQPPMSLSEGGLIHDGVDEDLDDLRNRLDEQ
FT                   ENWLAGVEKRERKASSNPNLRLQFHRSFGYFLAVSRAKATAVPDHWIRRQTLSNEERFV
FT                   TPELKEREGRILQLKARSHQREYDLFCRLRDQVGEQATAIRDAARAVASLDALAGLAEL
FT                   AATQGYCRPELTDGRCLEIEGGRHPVVEQLLSESAFVPNSVALGHGDKPDLVVLTGPNA
FT                   SGKSCYLRQCGVLQLMAQMGSWIPAERAAIALADRIFTRVGAVDDLASGQSTFMVEMAE
FT                   TANILQHASERSLVLLDEIGRGTATFDGLSIAWAVAEHLASAPPHGLGARSIFATHYHE
FT                   LNALAGSHSNVANFQVVVEEQDAELVFLHKVMPGGADRSYGIEAARLAGVPPSVVQRAR
FT                   QMLERIEGGQPLAC"
     MAPGEQQLSL VPDDTIQGSL FAPEPSEDKT EESERPKQRR SHPGRRTAPA AQHNEDSSNN        60
     DDEGLPRWHH HGLVDPLALT PMLRHYVELK AAHPERVLLY RLGDFFECFF EDALLTSRLL       120
     ELTLTGKEGG KSIGRVPMAG IPHHAAERYC SELVRRGHAV ALCDQLETTA AKGALLKRDI       180
     TRVLTPGTVL EEGMLAARRN NWLAAVVLDD EQRWGLAVAD VSTGELLLHE RQGTTELQQQ       240
     LLQLEAAELL LPGIEAAEWC PDGLGLTQQP RTPFEAASAD RALKQRFGVR NLEGLGLADH       300
     PLARRAAGGL IAYLDASQPG STVPLERPQL VFAGDALVLD HQTRRNLELT ATQRDGQFQG       360
     SLLWAIDRSH TAMGGRALRR WLEAPLLDAT AIRGRQEAIT ELVEQRPLRL SVRRLLRPMA       420
     DLERLAGRCG AGRASARDLV ALADGLERLP LLADLLKSSS AAPLADLQQP RPDLQQLAEL       480
     LRFQLVDQPP MSLSEGGLIH DGVDEDLDDL RNRLDEQENW LAGVEKRERK ASSNPNLRLQ       540
     FHRSFGYFLA VSRAKATAVP DHWIRRQTLS NEERFVTPEL KEREGRILQL KARSHQREYD       600
     LFCRLRDQVG EQATAIRDAA RAVASLDALA GLAELAATQG YCRPELTDGR CLEIEGGRHP       660
     VVEQLLSESA FVPNSVALGH GDKPDLVVLT GPNASGKSCY LRQCGVLQLM AQMGSWIPAE       720
     RAAIALADRI FTRVGAVDDL ASGQSTFMVE MAETANILQH ASERSLVLLD EIGRGTATFD       780
     GLSIAWAVAE HLASAPPHGL GARSIFATHY HELNALAGSH SNVANFQVVV EEQDAELVFL       840
     HKVMPGGADR SYGIEAARLA GVPPSVVQRA RQMLERIEGG QPLAC                       885
//

If you have problems or comments...

PBIL Back to PBIL home page