(data stored in ACNUC29543 zone)

EMBL: CT978603.NBLB

CT978603.NBLB        Location/Qualifiers
FT   CDS             122923..123456
FT                   /transl_table=11
FT                   /gene="nblB"
FT                   /locus_tag="SynRCC307_0128"
FT                   /product="Putative NblB protein (PBS lyase with HEAT-like
FT                   repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27031"
FT                   /db_xref="GOA:A5GQ72"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ72"
FT                   /protein_id="CAK27031.1"
FT                   /translation="MSTEAQQPSGMDLPAIEAAITSGDTTLRMRAITAMQPFEPQECVP
FT                   LLLQCLDDDAFVVRSLACMGLGYKRNPQGLQALLKVMQAESDHNVRAEAANAVARHGGE
FT                   QALQALLDLYARDEHWLVRTSILAAMAAEDDMPMEPLQQLAEQGCADDNETVREAGQGL
FT                   KLRLQQRRLEKLLP"
     MSTEAQQPSG MDLPAIEAAI TSGDTTLRMR AITAMQPFEP QECVPLLLQC LDDDAFVVRS        60
     LACMGLGYKR NPQGLQALLK VMQAESDHNV RAEAANAVAR HGGEQALQAL LDLYARDEHW       120
     LVRTSILAAM AAEDDMPMEP LQQLAEQGCA DDNETVREAG QGLKLRLQQR RLEKLLP          177
//

If you have problems or comments...

PBIL Back to PBIL home page