(data stored in ACNUC29543 zone)

EMBL: CT978603.NDHK,-NUKC

CT978603.NDHK,-NUKC  Location/Qualifiers
FT   CDS             213170..213898
FT                   /transl_table=11
FT                   /gene="ndhK, nukC"
FT                   /locus_tag="SynRCC307_0214"
FT                   /product="NAD(P)H-quinone oxidoreductase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27117"
FT                   /db_xref="GOA:A5GQF8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF8"
FT                   /protein_id="CAK27117.1"
FT                   /translation="MSDTSLDSMRDLRAASCGPVGSPEVTTDLSENVILTSLDDLHNWA
FT                   RLSSLWPLLYGTACCFIEFAALIGSRFDFDRFGLVPRSSPRQADLLIVAGTVTMKMAPA
FT                   LVRLYEQMPEPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPPRPEAIF
FT                   DAVIKLRKKVGDEAIAERGKLEQTHRYSTVEHRMTAVDPIVDGRYLRAETQQKALAAAE
FT                   AVSPLNLAPAEQPETIPAKS"
     MSDTSLDSMR DLRAASCGPV GSPEVTTDLS ENVILTSLDD LHNWARLSSL WPLLYGTACC        60
     FIEFAALIGS RFDFDRFGLV PRSSPRQADL LIVAGTVTMK MAPALVRLYE QMPEPKYVIA       120
     MGACTITGGM FSADSTTAVR GVDKLIPVDL YLPGCPPRPE AIFDAVIKLR KKVGDEAIAE       180
     RGKLEQTHRY STVEHRMTAV DPIVDGRYLR AETQQKALAA AEAVSPLNLA PAEQPETIPA       240
     KS                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page