(data stored in ACNUC29543 zone)

EMBL: CT978603.PE102

CT978603.PE102       Location/Qualifiers
FT   CDS             100196..100954
FT                   /transl_table=11
FT                   /gene="SynRCC307_0102"
FT                   /locus_tag="SynRCC307_0102"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27005"
FT                   /db_xref="GOA:A5GQ46"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ46"
FT                   /protein_id="CAK27005.1"
FT                   /translation="MPYLINQKLFFVHIPKTAGSSIERAFGVHPSCNKTTSNSSASLRS
FT                   GPSLVNDVLRKTINLGLSFFASSSKHKEKNNFLIGYDQPSLVLQHLTLSEMFWLGYLSQ
FT                   AELSKSTFFSVVRHPKDRIISAWRSHQRHVEFPDINDFIESRLNSLSCTTHDERAHIRP
FT                   MSHYLDISNLPCPIRLHVLRLETIQTCWSSFGERVLRDPSINLRSWPSLPHYGSNRSHV
FT                   SPVSNQSLTVKSADLIKRYYSCDYENFAYQ"
     MPYLINQKLF FVHIPKTAGS SIERAFGVHP SCNKTTSNSS ASLRSGPSLV NDVLRKTINL        60
     GLSFFASSSK HKEKNNFLIG YDQPSLVLQH LTLSEMFWLG YLSQAELSKS TFFSVVRHPK       120
     DRIISAWRSH QRHVEFPDIN DFIESRLNSL SCTTHDERAH IRPMSHYLDI SNLPCPIRLH       180
     VLRLETIQTC WSSFGERVLR DPSINLRSWP SLPHYGSNRS HVSPVSNQSL TVKSADLIKR       240
     YYSCDYENFA YQ                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page