(data stored in ACNUC29543 zone)

EMBL: CT978603.PE118

CT978603.PE118       Location/Qualifiers
FT   CDS             complement(113737..113973)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0118"
FT                   /locus_tag="SynRCC307_0118"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27021"
FT                   /db_xref="InterPro:IPR030810"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ62"
FT                   /protein_id="CAK27021.1"
FT                   /translation="MGREEQRAAVRRMRESLIEELEGVYRRAFDAIGSDDMGEGAVARL
FT                   TQLLLRSREGAIAPLQEEIEAPLITKAPEPPQS"
     MGREEQRAAV RRMRESLIEE LEGVYRRAFD AIGSDDMGEG AVARLTQLLL RSREGAIAPL        60
     QEEIEAPLIT KAPEPPQS                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page