(data stored in ACNUC29543 zone)

EMBL: CT978603.PE122

CT978603.PE122       Location/Qualifiers
FT   CDS             117231..119204
FT                   /transl_table=11
FT                   /gene="SynRCC307_0122"
FT                   /locus_tag="SynRCC307_0122"
FT                   /product="Possible serine/threonine protein kinase"
FT                   /note="General function prediction only / Signal
FT                   transduction mechanisms / Transcription / DNA replication,
FT                   recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27025"
FT                   /db_xref="GOA:A5GQ66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ66"
FT                   /protein_id="CAK27025.1"
FT                   /translation="MAVPTPAEAASGALLERRYRLDEVLSEAEGTRLWRGADTLVGELP
FT                   VAIRAWWGLTDEELAALQQRLERLKAVLHPQIPRLGEQLPAEGGCWQVREWISGRTYQD
FT                   LLQARQERQLVFGSGEVLLLLRQLLPALAALHGQNLVHGDLTPANLVRRDSDGLPVLID
FT                   FGLQAAVVGQPLTAATAGYAPPQARHEPYGLWMDLYSLGVVALVLLSGEEPAALMDPVS
FT                   LAWRWPEGIDLDAAFRQVLERLLATSPEQRFNSAAEVAEALTALPVPESTGPVSRSDRT
FT                   AVLLPQLKPEQQAEASPAPAPTRPTRDERRRAKEQAAEGRFWPVVIALLLAALVGSALG
FT                   WLLLGRNRQSNRPASALAPELSLPPAELDQRQQLLNRLRALQVDQAWFLKLVDSSLAAQ
FT                   FPERGGRAPTDSLEDAPLRKIWNDLAQEWLVRVEQLPVPLRQRLGSYTDADWKQREKSL
FT                   TKEGLSPLVLRQLVSSSAQNLLPGRNPETIPAEPVRQIWYAAALRSLEGLKVEQLKPVL
FT                   NVPSSLSTSVDGQGAKLIAINVPKNHRLVLGVNGTPLMQMSLFAANGKVLEPRGPLRVL
FT                   SVARVENSPVQLLIRNDGLAPGLISLSVRVDPPLPKPARETQRPRQQQPSAQPPNQPQP
FT                   QTPKQDSVLDEIKQPTVDPFGN"
     MAVPTPAEAA SGALLERRYR LDEVLSEAEG TRLWRGADTL VGELPVAIRA WWGLTDEELA        60
     ALQQRLERLK AVLHPQIPRL GEQLPAEGGC WQVREWISGR TYQDLLQARQ ERQLVFGSGE       120
     VLLLLRQLLP ALAALHGQNL VHGDLTPANL VRRDSDGLPV LIDFGLQAAV VGQPLTAATA       180
     GYAPPQARHE PYGLWMDLYS LGVVALVLLS GEEPAALMDP VSLAWRWPEG IDLDAAFRQV       240
     LERLLATSPE QRFNSAAEVA EALTALPVPE STGPVSRSDR TAVLLPQLKP EQQAEASPAP       300
     APTRPTRDER RRAKEQAAEG RFWPVVIALL LAALVGSALG WLLLGRNRQS NRPASALAPE       360
     LSLPPAELDQ RQQLLNRLRA LQVDQAWFLK LVDSSLAAQF PERGGRAPTD SLEDAPLRKI       420
     WNDLAQEWLV RVEQLPVPLR QRLGSYTDAD WKQREKSLTK EGLSPLVLRQ LVSSSAQNLL       480
     PGRNPETIPA EPVRQIWYAA ALRSLEGLKV EQLKPVLNVP SSLSTSVDGQ GAKLIAINVP       540
     KNHRLVLGVN GTPLMQMSLF AANGKVLEPR GPLRVLSVAR VENSPVQLLI RNDGLAPGLI       600
     SLSVRVDPPL PKPARETQRP RQQQPSAQPP NQPQPQTPKQ DSVLDEIKQP TVDPFGN          657
//

If you have problems or comments...

PBIL Back to PBIL home page