(data stored in ACNUC29543 zone)

EMBL: CT978603.PE125

CT978603.PE125       Location/Qualifiers
FT   CDS             120790..121548
FT                   /transl_table=11
FT                   /gene="SynRCC307_0125"
FT                   /locus_tag="SynRCC307_0125"
FT                   /product="Secreted tetratricopeptide repeat domains
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27028"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ69"
FT                   /protein_id="CAK27028.1"
FT                   /translation="MAWLMPTLLALLLGTTGLADQFHQALEASQQGRFAEALGLWDGVI
FT                   ELAPADSAAWSNRGNVRLALGDPEGAIADQTEAIRLEPEAIDPHLNRGTAEEALAQWDQ
FT                   AAADYNWILERQPDEAAALYNLGNVAGSLGDWPAARERFEAASLAQPGMAMARSSAALA
FT                   AFQIDELETSEKELRRLIRRYPLFADARAALTALLWQQGNAGEAESHWAAASGLDERYS
FT                   DPQWLLQVRRWPPEPVSALQRFLALDGGQP"
     MAWLMPTLLA LLLGTTGLAD QFHQALEASQ QGRFAEALGL WDGVIELAPA DSAAWSNRGN        60
     VRLALGDPEG AIADQTEAIR LEPEAIDPHL NRGTAEEALA QWDQAAADYN WILERQPDEA       120
     AALYNLGNVA GSLGDWPAAR ERFEAASLAQ PGMAMARSSA ALAAFQIDEL ETSEKELRRL       180
     IRRYPLFADA RAALTALLWQ QGNAGEAESH WAAASGLDER YSDPQWLLQV RRWPPEPVSA       240
     LQRFLALDGG QP                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page